KEGG   Thalassiosira pseudonana: THAPSDRAFT_37366Help
Entry
THAPSDRAFT_37366  CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K11858  ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THAPSDRAFT_37366
Peptidases [BR:tps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THAPSDRAFT_37366
Ubiquitin system [BR:tps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    THAPSDRAFT_37366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 7452721
NCBI-ProteinID: XP_002293964
JGI: 37366
UniProt: B8CCM4
Position
14
AA seq 169 aa AA seqDB search
IFGGTYLYTTKCSDCGTTSERRENFMDISLPIDISNDVDVKRCLDSYTRPEFLDGDNQYL
CSGCNKKNDAVRSLVFERLPPVLNLQLARYVFDYESYNKKKISTKVLLPRTLEVSRASSN
SNDDKSVYILCAVQNHLGTSAHGGHYVAECLDWMTGLWYEFNDDEVKLL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atcttcggagggacttatttatacacaacaaagtgctctgattgtggaaccacatcggag
aggagagagaatttcatggacatctctctccctattgacatttccaatgacgtggatgtt
aagcgttgccttgattcctatacccgtcccgaattcctcgacggcgacaaccaatatctc
tgctctgggtgcaacaaaaagaatgatgcagtgagaagtttggtatttgaaaggttgcct
cctgttctcaatctacaattggcacgatacgtctttgactatgagtcgtacaataagaag
aagatatcaaccaaagtgttgctgcctcgaactctggaggtgtctagagcaagctctaat
agcaacgacgacaaatcagtctacattctgtgtgctgttcagaatcatcttggaacttct
gcacacggtggacattacgttgccgaatgcctagattggatgacgggattgtggtacgag
ttcaacgacgacgaagtaaaactgctc

DBGET integrated database retrieval system