KEGG   Thalassiosira pseudonana: THAPSDRAFT_37443Help
Entry
THAPSDRAFT_37443  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tps  Thalassiosira pseudonana
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    THAPSDRAFT_37443
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     THAPSDRAFT_37443
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     THAPSDRAFT_37443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 205 aa AA seqDB search
MVEQSPDSEWPDAWLMPDGDCANQKAANKQEPNVPVTVKELKDLGICYWKLDASAYEYPT
ISVPWDPKDAVDPKLSQIRDDRGYSYADIITVHPEKLPEYDTKVKAFFEEHIHDAEEIRY
ILGGSGYFDVRNKKDEWVRIHIKAGDLMTLPEGIYHRFTVDETDMIHAMRLFIGQPVWTP
FNRPCDEHDSRVKYVKGYLEEEKKE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacaatctcctgattctgaatggcctgacgcgtggctaatgcccgatggcgac
tgtgccaatcagaaggctgcaaacaagcaagagccgaatgttcctgtgacggtgaaggag
ttgaaggatcttggtatttgctactggaaactcgatgcatccgcttacgagtaccccacg
atttccgtgccttgggaccccaaagacgccgtcgacccaaaactttcccaaatccgtgac
gaccgtggatactcctatgcagacatcatcaccgttcaccctgaaaagcttcccgagtac
gacaccaaagtcaaggccttcttcgaagaacatatccatgatgcggaagagatccgctac
attttgggaggatctggatactttgatgtacgcaacaaaaaggacgagtgggtacgaatt
catatcaaggctggagatttgatgactttaccggaggggatctatcatcgttttacggtg
gatgagacggatatgattcatgccatgaggttgtttatcggtcagcctgtttggactccg
tttaacaggccttgtgacgagcatgatagtcgtgtgaagtacgtgaaggggtacttggag
gaagagaagaaggagtaa

DBGET integrated database retrieval system