KEGG   Thalassiosira pseudonana: THAPSDRAFT_37471Help
Entry
THAPSDRAFT_37471  CDS       T01078                                 

Gene name
DPS1
Definition
dihydropteroate synthetase (EC:2.5.1.15)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
tps  Thalassiosira pseudonana
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tps00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 509 aa AA seqDB search
MQLRGGGTARNSTTQQTKQPWRRAYLAVGSNMGNQYQNIATALSLLQADGAVRLIRTSHL
RMTAPMYITDQPAFLNGAVEIETLLTPLELLRSIKKVESGVGRDLSGNTQRFGPRPVDLD
ILLFDGYDIENEDGSAADTLDDNNVNPSSLVMQTDALEIPHPRMAEREFVLSPMCDLERG
TEIIHPVLNKTMTKLLTLLVRGTNKNTTKDEPEQAMRVLPLPRGRMLIFNETIVMGILNV
TPDSFSDGGKYSDSAEAAAIQALQMEKDGARIIDVGGESTRPGAEEVGVEEELRRVLPVI
TRIREESDIPISIDTRHSEVAQAAIEAGADIVNDVSGGMHDAAMLQCVASLGVPIILMHM
RGNPKTMQSLTNYTASDGVVSGVISELSERSAAAEAAGIPQWLQVLDPGIGFAKNIEDNL
SLLKEVDTLRQLCNNLPFLFGPSRKGFIGKLLGETNAEDRDFGTIAACLATLRSSVGKYD
ACNILRVHNVKAVKQAVLVYEAIVYAEKK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcaactacgaggaggaggcactgcacgaaactcaacaacccaacaaacaaaacaacca
tggagaagagcttacctagcagtaggatcaaacatgggcaaccaataccaaaacattgcc
accgcattatcactcctccaagccgacggcgcagttcgactcatacgaacatcacaccta
cgcatgacggcacctatgtacatcactgatcaacctgcatttctgaatggagcagtggag
attgaaactttgctgactccgttggagttacttcgttctattaagaaagtggagagcggt
gttggaagagatttgagtggaaatacacagcggtttggaccgagacctgtggatttggat
attctattgtttgacggctatgatatagagaatgaggatgggtctgctgctgatacgctt
gatgataacaatgtgaatccatcatcacttgtaatgcagactgatgcattggagatacct
catccaagaatggctgaacgagagtttgtcctttcgccaatgtgtgatttggagaggggc
acagaaatcattcatcctgtactgaacaagactatgacaaaactgctgacattgttggtt
cgcggtacaaacaagaacacaacaaaagatgaaccagagcaagcaatgagagtactgccc
ttaccacgtggacgaatgctgatattcaacgaaacaatcgtcatgggcatactcaacgta
actccagacagcttcagcgatggtggaaagtactctgattctgccgaggctgctgctatt
caagctcttcaaatggaaaaggatggagctagaatcatcgatgtgggtggcgagtcgact
cgtcctggtgctgaggaagtgggtgtggaagaggagcttcgacgagtgttgcctgtgatt
acaagaatacgtgaagaatctgatataccaatatccatcgatacacgacattcggaggta
gcccaagctgccatcgaagcaggggcagacattgtcaatgatgtttcgggaggaatgcac
gatgcagcaatgcttcaatgtgtcgcctctttgggagtacccatcattctgatgcatatg
cgaggcaatccgaagactatgcagtcattaacaaactatactgcgagcgatggtgttgta
tctggtgtgatttccgagttgagcgaaagatccgcagcggcagaggcagcaggaataccg
caatggctacaagtactcgatccaggcattggctttgcaaagaatattgaagacaatcta
tccctgctgaaagaagtggatactctacgacaattgtgtaacaatctgccgttcttattt
ggaccaagccgcaaaggctttattggcaaacttttgggagagaccaatgccgaggacaga
gactttggtaccattgctgcttgcctggctacgttgaggagtagcgttggtaagtatgat
gcgtgcaatatactgcgagtgcataatgtcaaggctgtgaagcaggctgtgcttgtatat
gaagcgattgtgtatgcagagaagaaatga

DBGET integrated database retrieval system