KEGG   Thalassiosira pseudonana: THAPSDRAFT_37471Help
Entry
THAPSDRAFT_37471  CDS       T01078                                 

Gene name
DPS1
Definition
dihydropteroate synthetase (EC:2.5.1.15)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
tps  Thalassiosira pseudonana
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THAPSDRAFT_37471 (DPS1)
Enzymes [BR:tps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     THAPSDRAFT_37471 (DPS1)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     THAPSDRAFT_37471 (DPS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 509 aa AA seqDB search
MQLRGGGTARNSTTQQTKQPWRRAYLAVGSNMGNQYQNIATALSLLQADGAVRLIRTSHL
RMTAPMYITDQPAFLNGAVEIETLLTPLELLRSIKKVESGVGRDLSGNTQRFGPRPVDLD
ILLFDGYDIENEDGSAADTLDDNNVNPSSLVMQTDALEIPHPRMAEREFVLSPMCDLERG
TEIIHPVLNKTMTKLLTLLVRGTNKNTTKDEPEQAMRVLPLPRGRMLIFNETIVMGILNV
TPDSFSDGGKYSDSAEAAAIQALQMEKDGARIIDVGGESTRPGAEEVGVEEELRRVLPVI
TRIREESDIPISIDTRHSEVAQAAIEAGADIVNDVSGGMHDAAMLQCVASLGVPIILMHM
RGNPKTMQSLTNYTASDGVVSGVISELSERSAAAEAAGIPQWLQVLDPGIGFAKNIEDNL
SLLKEVDTLRQLCNNLPFLFGPSRKGFIGKLLGETNAEDRDFGTIAACLATLRSSVGKYD
ACNILRVHNVKAVKQAVLVYEAIVYAEKK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcaactacgaggaggaggcactgcacgaaactcaacaacccaacaaacaaaacaacca
tggagaagagcttacctagcagtaggatcaaacatgggcaaccaataccaaaacattgcc
accgcattatcactcctccaagccgacggcgcagttcgactcatacgaacatcacaccta
cgcatgacggcacctatgtacatcactgatcaacctgcatttctgaatggagcagtggag
attgaaactttgctgactccgttggagttacttcgttctattaagaaagtggagagcggt
gttggaagagatttgagtggaaatacacagcggtttggaccgagacctgtggatttggat
attctattgtttgacggctatgatatagagaatgaggatgggtctgctgctgatacgctt
gatgataacaatgtgaatccatcatcacttgtaatgcagactgatgcattggagatacct
catccaagaatggctgaacgagagtttgtcctttcgccaatgtgtgatttggagaggggc
acagaaatcattcatcctgtactgaacaagactatgacaaaactgctgacattgttggtt
cgcggtacaaacaagaacacaacaaaagatgaaccagagcaagcaatgagagtactgccc
ttaccacgtggacgaatgctgatattcaacgaaacaatcgtcatgggcatactcaacgta
actccagacagcttcagcgatggtggaaagtactctgattctgccgaggctgctgctatt
caagctcttcaaatggaaaaggatggagctagaatcatcgatgtgggtggcgagtcgact
cgtcctggtgctgaggaagtgggtgtggaagaggagcttcgacgagtgttgcctgtgatt
acaagaatacgtgaagaatctgatataccaatatccatcgatacacgacattcggaggta
gcccaagctgccatcgaagcaggggcagacattgtcaatgatgtttcgggaggaatgcac
gatgcagcaatgcttcaatgtgtcgcctctttgggagtacccatcattctgatgcatatg
cgaggcaatccgaagactatgcagtcattaacaaactatactgcgagcgatggtgttgta
tctggtgtgatttccgagttgagcgaaagatccgcagcggcagaggcagcaggaataccg
caatggctacaagtactcgatccaggcattggctttgcaaagaatattgaagacaatcta
tccctgctgaaagaagtggatactctacgacaattgtgtaacaatctgccgttcttattt
ggaccaagccgcaaaggctttattggcaaacttttgggagagaccaatgccgaggacaga
gactttggtaccattgctgcttgcctggctacgttgaggagtagcgttggtaagtatgat
gcgtgcaatatactgcgagtgcataatgtcaaggctgtgaagcaggctgtgcttgtatat
gaagcgattgtgtatgcagagaagaaatga

DBGET integrated database retrieval system