KEGG   Thalassiosira pseudonana: THAPSDRAFT_37571Help
Entry
THAPSDRAFT_37571  CDS       T01078                                 

Definition
pyruvate dehydrogenase kinase (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tps  Thalassiosira pseudonana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15
AA seq 338 aa AA seqDB search
SEATPLVLLQVASFLRRELPIRLAHRIQDLSRVPLLQDMKSVQQVKELYTTSFLEIMSVD
KHPPTREGQEEWEEHFAKILENIYERHSSVLVQMARGAFELRRDAVEFELMESTHAFLDR
FYISRIGIRVLIGQYLSLRQPPVENYVGIICSKTSPYEIVKRAIDDAAFMCTRKYGDAPE
VIITGRLDMTFPYVPTHLHYIMLELLKNSMRATVEYHGVDADYPPIKVVIADGKDNEDVI
IKVSDEGGGIPRSNMKRIWSYLFTTADPEIQEGMVAFNENVDHSIDSPLAGLGYGLPISR
SYTRYFGGDLSIMSMEGYGTDCFVYLTRLGNTREPLPI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
tcggaggcgactcccctggtgttgctgcaggtggcttctttcttacgtcgcgagctgccc
attcgactggcacaccgtattcaggatctatctcgcgtgcctctacttcaagatatgaaa
tctgtacaacaagtgaaggaattgtataccacatccttccttgagataatgtcagttgac
aaacaccctcccacgcgagaggggcaggaagagtgggaagaacactttgcaaagatccta
gaaaatatatacgagagacattcttctgtattggtccaaatggcacggggggcatttgaa
ctgcgtcgagatgcagtggaatttgaacttatggaatcaacgcacgcttttcttgataga
ttctacatctcacgtattggaatacgagtgttgattggtcagtatttgtctttgaggcag
cctccggtggagaattatgtggggattatttgcagtaagacaagtccgtatgagattgtc
aagagggcgattgatgatgctgcttttatgtgtacgaggaagtatggggatgccccggag
gtgattattacgggcagattggacatgacgtttccctacgtcccaactcatcttcattac
atcatgttggagcttctcaaaaactcaatgcgagccacggttgaataccatggagtcgat
gcagactatcctccgattaaggttgtaattgcagatgggaaagataacgaggatgtaatt
atcaaggtgtcagacgagggtggtgggattccgaggagtaacatgaagagaatttggagc
tacctcttcactacagctgatccagaaatccaagaggggatggttgccttcaatgaaaat
gtagatcacagtattgattctccgttggcagggttagggtatggattaccgattagtcga
agctatacaaggtatttcggtggtgatctgagcatcatgagcatggaggggtacgggacg
gattgctttgtgtacttgacacgtttggggaacacgagggagccactgccaatctaa

DBGET integrated database retrieval system