KEGG   Thalassiosira pseudonana: THAPSDRAFT_37810Help
Entry
THAPSDRAFT_37810  CDS       T01078                                 

Definition
guanylate kinase-like protein (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tps  Thalassiosira pseudonana
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    THAPSDRAFT_37810
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     THAPSDRAFT_37810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 193 aa AA seqDB search
MASNHTPPPRPIIICGPSGVGKGTLIARITNKYRTQFGFSISHTTRAPREGEEDAVHYHF
CSVEEVKRGIDGGQFLEWAEVHGNYYGTSIKSVQSVQNQGKICILDIDVQAVQSIKKYIS
QNSSSQLNPVYLFIAPPSLQTLEQRLRGRNTENEEAIQKRLAIAKTEVEYGLQEGNFDAV
LVNDDLERCFEEL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaaccacacacctccgccgcgtccaatcatcatctgcggccccagtggcgtc
ggcaaaggcaccctgatcgcccgcataacgaacaaataccgcacccaattcggattcagc
atcagccacacgacgcgtgcaccgcgggagggagaggaggatgcagtgcattatcacttt
tgtagtgtggaggaggtgaagagagggattgatggggggcagtttttggagtgggcggag
gttcatggtaattattatggtacgagcatcaaatcagtccaatccgtacaaaaccaagga
aagatatgcatcctagacattgacgtacaagcagtccaatccatcaaaaagtacatatcc
caaaactcatcgtcacaactcaatccagtctacctattcatcgcaccaccctccctccaa
acactcgaacaacgtctccgaggtcgcaacactgaaaacgaagaggcgattcaaaaacga
ctggcaattgccaagactgaagtggagtatggattacaagaaggaaactttgatgctgtt
ttggtgaatgatgatctggagaggtgtttcgaggagttg

DBGET integrated database retrieval system