KEGG   Thalassiosira pseudonana: THAPSDRAFT_38736Help
Entry
THAPSDRAFT_38736  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     THAPSDRAFT_38736
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   THAPSDRAFT_38736
Spliceosome [BR:tps03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    THAPSDRAFT_38736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
22
AA seq 332 aa AA seqDB search
LGMGTFGRVVQCEDLRRSRGRDRDREFGKTVAIKIVRNVRRYYDSALIEADICERVNREQ
SRKNKDLCAKMLDRFSLSSGHYCLVFECLGRSLYDFLKMHAYRPFPMFCVRDFARQLLVA
LDFLHGFGLIHTDLKPENILLTHNEETTYRAWNGSSYRVPVSTKVKVIDFGGATYDNEKK
STIVNTRQYRAPEVILGFETWSFPSDLWSAGCIIAELYSGGLLFATHQNAEHLALMERAV
GPFRKSVLDRSTSSLARKCFDSRGWHKINGVLSSRSIEHVRKMKPIEQFVLEHDRPTGLG
KLLRRLLTIEPRRRATAKEALGLSFFTKPLLR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttaggcatgggaacgttcggtcgcgtcgtacagtgtgaagacttgcgtcgctctcgtgga
cgagacagagaccgtgaattcggaaaaacagtcgccatcaaaatcgtccgaaacgtacga
cgatactacgacagtgcactaatcgaggcagacatttgtgaacgagtcaacagagagcaa
agtcgtaaaaacaaagacttgtgtgcaaaaatgttggaccgatttagcctgagcagtggg
cactactgtctcgtgtttgaatgcctcgggagatcactgtatgactttttgaagatgcat
gcgtatcgtccgttcccaatgttttgtgtccgtgatttcgcgaggcagttgttggtggca
ctggactttttgcatggctttggtttgattcatactgatctaaagcccgagaatatcctt
cttacacacaacgaagaaaccacataccgagcatggaacggttcttcctatcgtgtcccc
gtctccacaaaagtaaaggtgatcgatttcggtggagccacctacgacaacgaaaagaaa
tccaccatagtcaacactcgacaatatcgcgcccccgaagttatcctcggctttgaaacg
tggtccttcccatccgatctatggagtgccggctgcatcatcgcggaactatactcggga
ggactactttttgcaacacaccaaaatgcggaacatttggcgttgatggaacgagccgta
ggtccctttcgtaagagtgtgctcgatcgatctacttcctctcttgcacgaaaatgcttt
gattcacgtggctggcataaaatcaacggagtactatcttcgaggagtattgaacatgtg
aggaaaatgaaaccgattgaacagttcgttttggaacatgatcgtccgacggggttgggt
aaattgttaaggcggttgttgacgattgagccgaggaggagggctacggcaaaggaggct
ttgggactttcgttctttacgaaacctttgttaagatga

DBGET integrated database retrieval system