KEGG   Thalassiosira pseudonana: THAPSDRAFT_39726Help
Entry
THAPSDRAFT_39726  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tps  Thalassiosira pseudonana
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:tps04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 357 aa AA seqDB search
MTPAQKEDDGDVAVDLEAESKCVGQVLQLLCSFGAAYKYLCQHRSQDALELFRELPSSQI
NTGWVQHQIGKAYFEMSDYQNAERALGKMQRAEPHRMKGLDILSTALWHLKKEVELSDLA
QKAVDFDRMSPEAWFVVGNCFSFQKEQETAITFFHRSIQLDPTYTYAHTMCGHEYMSNED
FEKAISCYRDAIRVDCRHYNAWYGLGAIYFRQEKFDLAEYHFQRALDINRQSSVLHCHLG
MAQHHNGKTFEALDTLAGAFLLDPRNPQAHYQRATIFMSLDRPDEALAELEKVRSAAPRE
ASVHYNMGKVLKRLGRPEKAMRCFLTALDLDPKDNNLIKAAMDRLDEPDVEEEVSVF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgcccagaaggaggatgatggggatgttgccgttgacttggaagcggagagt
aaatgtgtggggcaggtgcttcagttgttgtgttcgtttggtgctgcgtacaagtatctt
tgtcagcatcgctctcaggatgcgttggagttgttccgagagctaccatcttcgcagatc
aatacgggatgggtgcagcatcagattggtaaagcgtactttgaaatgtcagactatcaa
aatgcagaacgagctctcggaaagatgcaacgggcagagcctcatcgtatgaaaggactt
gatattttgtctacggcgctgtggcatctcaagaaagaagtggagctgtcagatctagcc
caaaaggcagtggactttgacaggatgtcaccagaggcgtggtttgtggttggcaattgc
ttctcgttccagaaagaacaagagactgcaattacattcttccacagatctattcagctt
gatccaacgtacacgtatgcacacacgatgtgtggccacgagtatatgtcaaacgaagac
tttgaaaaggctatttcctgttaccgcgatgcgattcgagtggattgccgtcattataat
gcttggtatggcttgggagcaatctacttccgccaggagaagtttgatcttgctgaatat
catttccaacgtgcgttggatatcaatcgacagagctctgtgcttcactgtcacttagga
atggctcagcatcacaacggaaagacatttgaagctctcgatacactggctggtgccttc
cttcttgatccaaggaatcctcaagctcattaccaaagagcaacaatcttcatgtcactg
gatcgtccagatgaggcattggctgagttggagaaggttcgttcagcagcaccacgggaa
gcatccgtgcattacaacatgggaaaggtcctgaaacgtttaggtcgaccagaaaaggca
atgaggtgcttcttgacggctcttgacttggatccaaaggataacaatctgatcaaggcg
gctatggatagactcgacgagcccgacgtggaggaagaagtgtctgtgttttga

DBGET integrated database retrieval system