KEGG   Thalassiosira pseudonana: THAPSDRAFT_40798Help
Entry
THAPSDRAFT_40798  CDS       T01078                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
tps  Thalassiosira pseudonana
Pathway
tps03013  RNA transport
Module
tps_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THAPSDRAFT_40798
Messenger RNA biogenesis [BR:tps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     THAPSDRAFT_40798
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     THAPSDRAFT_40798
Translation factors [BR:tps03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    THAPSDRAFT_40798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 7445186
NCBI-ProteinID: XP_002290792
JGI: 40798
UniProt: B8C3D4
Position
5
AA seq 190 aa AA seqDB search
MSSTPTPLHHKWTLWYDNPRLAPAGTDWHDNLKNLGTFQTAEEFWAIFNNIQPSSHLALN
SNYHLFKEGIEPMWEDPANQNGGKFVLTIPKKEAKAGRGDEWWLFTVLAVIGETMDQSGE
EVCGCVVSIRKAQDRIALWLKSCDKKACTEVGARWKKCLEVSNKTGLKYQAHKDAAASGS
SFKNEVKFEV
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgacaccaacccccctccaccacaaatggactctctggtacgacaacccccgc
ctcgccccagcaggcaccgactggcacgacaatctcaaaaacctcggcacattccaaacc
gccgaggagttctgggctatattcaacaacattcaaccatcaagtcatctcgccttgaat
agcaattaccacttgttcaaagaggggattgaaccaatgtgggaagaccccgccaatcaa
aatggggggaaatttgtgttgactattcctaagaaagaggctaaggctggaagaggggat
gaatggtggttattcaccgtccttgcagtgattggtgaaacgatggatcagtcgggagaa
gaagtttgtggatgtgtggtatcgattcgtaaggctcaggataggattgcgttgtggctg
aagagttgtgataagaaggcttgtacggaggtgggagcgaggtggaagaaatgtttggag
gtttcgaataagactggtttgaagtatcaggcacataaggatgctgccgcaagtggaagc
tcatttaagaatgaggtcaagtttgaagtataa

DBGET integrated database retrieval system