KEGG   Thalassiosira pseudonana: THAPSDRAFT_41025Help
Entry
THAPSDRAFT_41025  CDS       T01078                                 

Definition
(RefSeq) histone deacetylase 1p
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     THAPSDRAFT_41025
Chromosome [BR:tps03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     THAPSDRAFT_41025
   HDAC complexes
    Sin3A-HDAC complex
     THAPSDRAFT_41025
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    THAPSDRAFT_41025
  Chromatin remodeling factors
   NuRD complex
    THAPSDRAFT_41025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 450 aa AA seqDB search
MEPQSNPLSTDPTTLEASIPKGTSRRVSYFYDAEVGNYHYGQGHPMKPHRVRMTHNLVVN
YGLYKQMDVFRPRLIQSNAMTRFHSDDYINFLKVITPDNMTDFTRQLQRFNVGEDCPVFD
GLFEFCQLYTSGSIGGAARLNEDNADVVINWSGGLHHAKKAEASGFCYINDCVLAILELL
KKHERVLYIDIDIHHGDGVEEAFYSTNRVMTVSFHKFGEYFPGTGDVLDTGYADGKNYAI
NFPLNDGMDDEAYHSIFKPVMSKVMEHFAPGAVVLQCGADSLSGDRLGCFNLSVKGHAEC
VNFVRSFNIPMLVLGGGGYTLRNVPRCWTYETAVVVGEPVNENLPFNDYYEYFGPDYTLH
LPVSNMENLNSKEYLSKTKNQLIDILRDVEPVPGTQIQTGQVESQLNPRGVSMEIDEPSK
SDGGNGSNNPDERGDSRLDGGKEHPAELAS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggagccccaatccaaccccctcagtaccgacccaaccactctcgaagcctccatcccc
aagggcacctcccgccgcgtctcctacttctacgacgccgaggtgggcaactaccactat
ggccaaggccaccccatgaaaccccaccgcgtccgcatgacacacaacctcgtcgtcaac
tacggcctctacaaacaaatggatgttttccgccctcgtctcattcaatccaatgccatg
acgaggtttcatagtgacgattacatcaattttttgaaggtgattactcctgataacatg
acggattttaccaggcagcttcagaggtttaatgtgggggaggattgtccggtgtttgat
ggactatttgagttttgccaattgtacaccagtggaagtattgggggtgcggcacggttg
aatgaggataatgccgatgtggtgattaattggagtggaggacttcaccatgccaagaag
gcggaggcttcgggattttgctacatcaatgattgtgtgttggctattctcgagctgttg
aagaagcatgagagggtgctctatattgatattgatatccatcatggagatggtgtcgag
gaggcgttctactcgacgaaccgtgtcatgaccgtgtcatttcacaagtttggagagtac
ttccctggtacgggtgatgtgctagacactggatacgccgacgggaagaattacgccatc
aactttcccctcaacgacggtatggacgacgaagcataccactccatcttcaaaccggta
atgtcaaaggttatggagcacttcgctcccggagcagtggtcttacagtgtggtgccgat
tctctttcgggagatcgtcttggatgcttcaacctcagtgtcaagggacatgctgagtgt
gtcaactttgtgcgaagcttcaatatcccaatgttggtactcggaggagggggatacact
ctccgtaacgtcccgagatgctggacgtacgaaacagccgtggtggtgggagaaccggtg
aatgagaacttgcccttcaatgactactatgaatactttggtccggattacacccttcac
cttcccgtgtcgaatatggagaacctaaactccaaagagtacctctccaaaacgaaaaat
caactaatcgacattttgagggacgtggagccagtacctggtactcagattcagacggga
caggtggagagtcagttgaatcctcggggtgttagtatggaaattgatgaaccttcgaag
agtgatggagggaatggaagcaataatccggatgagaggggggatagtcggttggatgga
gggaaggagcaccctgccgagttggcgtcgtga

DBGET integrated database retrieval system