KEGG   Thalassiosira pseudonana: THAPSDRAFT_41038Help
Entry
THAPSDRAFT_41038  CDS       T01078                                 

Gene name
P5CS
Definition
(RefSeq) gamma-glutamyl phosphate reductase
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00330  Arginine and proline metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01230  Biosynthesis of amino acids
Module
tps_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    THAPSDRAFT_41038 (P5CS)
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     THAPSDRAFT_41038 (P5CS)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     THAPSDRAFT_41038 (P5CS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 7442351
NCBI-ProteinID: XP_002291080
JGI: 41038
UniProt: B8C5V7
Position
6
AA seq 732 aa AA seqDB search
MATYTEPESRRALRNTRRILIKAGTSVVANDDGRPSLTRLGAICEQIAEIHRSGVQVIMV
SSGATGMGKRLMRQHGRMNMSISEMASIGDGLDKLEMACAAAGQFEMMNLYNSLFSQMDV
SAAQVLLTEGDFRSEDHLNNLHYSIERLLSVGIIPIINENDAVSANRGYTQGDLFSDNDS
LAALCARSFACDLCILLTDVDGVFDRPPKEKGAKLLPFYSQNQSVGIGEKSKHGRGGMDS
KINAAQFAVSPGSQTRACVVISGADLNAIRSVTSKEYDPTLSKGPKGTFAESVSAEAHRM
ATAARDQARKLQGLSHSERKTILYAVADELQAEKVALLAANKLDLEIAERDGTEFPLVSR
LKLTEAKLATLSAGIRQIADQPDPLGVVKAKRELADGLVLSQITVPIGVLMIIFESRPDS
MPQISALALASGNGLLLKGGKEAAHSNEAIHKVIGNAVEKGSGGKITRDIIALVTSRGQV
ADMLKLDDVVDLVIPRGGNTLVSFIKANTRIPVLGHADGVCHVYVDKSANDTAAVCKLVV
DAKTDYPSACNAMETLLLHRDTLQATAVGNIAMSALMSLRAAGVKCLGGPKAMKTGLCDI
PAQEMKCEYGDLTCMVEIVEDMDEAIDWIHKYGSGHTESIVCADDSDAGEEFLKRVDAAC
VFKNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTVKWQLRSTGVNCVQEYGGG
DPQKVYTHKELI
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggccacatacacagagccagagtctcgcagggccctacgtaatacccgtcgtatcctc
atcaaagcgggaacctccgtcgtcgccaacgatgatgggcgtcctagtctgacacgcctc
ggtgcaatctgcgaacagatcgcagagatccatcgcagtggagtgcaggtgataatggtc
tccagtggggcaaccggtatgggaaagcgtttgatgcggcagcatggaaggatgaacatg
agtattagtgaaatggcgtcgattggtgatgggctagataagttggagatggcctgtgcc
gctgccggtcagtttgagatgatgaacttgtacaattcactcttctcgcagatggacgtg
tcagctgcccaggttctactaacagagggagattttcgaagtgaggatcatttgaacaat
ctgcactactccattgaacggttgctgagcgtgggtattattccaatcattaacgagaat
gatgcagtgagtgccaaccgtggatacactcagggagatttgttctctgataatgattct
ttggcagcattgtgtgcacgtagcttcgcgtgtgacttatgcatccttcttacggatgta
gacggtgtatttgatcgccctcctaaagagaagggagcgaagttgttgccattctacagt
caaaaccaatctgtaggtattggcgagaagagcaaacacggacgtggaggtatggattca
aagattaacgcagctcaatttgctgtaagcccaggatcacagactcgtgcatgtgttgtg
atttcgggtgctgatttgaacgctattcgatctgtgacaagcaaggagtatgatcctact
ctcagcaaagggccgaagggtacgtttgctgaatctgtttctgcagaggcgcacaggatg
gcaacggcggcacgtgatcaagcacgcaaactacaaggcctatctcattctgaacggaag
actatcctctacgctgtggcagatgagctgcaagcagaaaaggttgctttgctagcagcg
aataagctggatctcgagattgctgagcgtgacggaactgaatttccattggttagcaga
ttgaagttaacggaggccaaacttgctacactctcggctgggattcgtcagattgcagat
cagcctgatcctttgggtgtagtcaaagcaaaacgtgaattggccgatggacttgtgcta
tctcaaattactgttccaattggtgtcttgatgatcatcttcgagagtcgtccagactcg
atgcctcagatttctgctttggctcttgccagtggaaatgggttgttgttgaagggtggg
aaggaggctgctcattcaaacgaggcaattcataaggttattggaaatgcagttgagaaa
gggagcggaggaaagataaccagagatatcattgctttggtgactagtcgcggtcaggtg
gcagatatgctcaaacttgatgatgtggttgatttggtgattcctcgtggaggcaataca
cttgtatcgtttatcaaagcaaacactcgaatccctgttcttgggcatgcggatggtgtt
tgccacgtatatgttgacaagagcgccaatgacacagcagctgtgtgcaaactcgttgtg
gatgcaaagactgattacccctcggcatgcaatgcaatggagacactgctccttcatagg
gacacattacaagctactgcggtaggtaatattgccatgtcggctttgatgagcttacgt
gcggcaggagttaagtgtcttggaggtccaaaggctatgaagactggattgtgtgatatt
cccgctcaggaaatgaaatgtgaatatggcgatttgacatgcatggtagagattgttgag
gatatggacgaagctattgattggattcacaagtatggaagtggacacaccgaatctatc
gtttgtgctgatgatagtgatgcaggagaagagttcttgaagcgagttgacgctgcttgc
gtatttaagaatgcatcaacaaggtttgcagatggctatcgatttggactcggtgctgag
gttggaatttcaactggtcgtatccacgctcgtggacctgtcggcgtcgaaggattgttg
actgtcaagtggcagctacgttcaactggggtcaattgcgttcaggagtacggagggggt
gatcctcagaaagtgtacactcataaagagttgatctga

DBGET integrated database retrieval system