KEGG   Thalassiosira pseudonana: THAPSDRAFT_41530Help
Entry
THAPSDRAFT_41530  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
tps  Thalassiosira pseudonana
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    THAPSDRAFT_41530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 108 aa AA seqDB search
MSKPGNEKKGAKVFKTKCSQCHTVEAGGAHKQGPNLYGFFGRQSGLADGYSYSSANKKSG
IMWGEDTLFEYLENPKKYIKGTKMVFAGIKKPQERKDLIAYLQSTCSA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccaggtaacgagaagaagggagccaaggtcttcaagaccaagtgctctcaa
tgccataccgtcgaagcgggcggagcccacaagcagggacccaacctctatgggttcttc
ggccgtcagtctggattggccgacgggtattcgtattcgagcgccaataagaaaagtggt
atcatgtggggagaggataccctctttgaatatttggagaatcctaagaagtacatcaag
ggaactaagatggtcttcgctggaatcaaaaagccacaggaacgtaaggatcttattgcc
tacctccagtctacctgctctgcataa

DBGET integrated database retrieval system