KEGG   Thalassiosira pseudonana: THAPSDRAFT_5018Help
Entry
THAPSDRAFT_5018   CDS       T01078                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tps  Thalassiosira pseudonana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 514 aa AA seqDB search
MSSHHYQNYSMPNGVPSKQYTHNNQHHPVKHHAHHSYHHNNNRMTVDHRNDHEVRGSHSY
ESTRTGHASLGKDDHSIATATTAAFTSHAGSHSYSMDDGSVASEYGTEIVMNRTPGSIHG
GAYGRFKNSTPYSAHTFKAGNHTFTVDTKYSFNRVIGSGAYGVVISAHDTQLNTKVAIKM
VPKAFQDEIDAKRILREIKLLKHLKHENIVGIVDMMPPMYRYVDDFNDVYIVSELMETDL
YRIIYSKQSLSIDHVQYFIYQVLRALKYIHSANVLHRDLKPSNLLVNSNCDLKVCDFGLA
RGVYGEEEMNEGKKPLLTEYVVTRWYRAPEIMLACHEYDKPVDVWSTGCILAELLARKPY
FPGEDYIDQLTLITGKLGKLPEEELDFVTSEKARRFMRKLPNKPVVPLSQQFPETPPEAL
DLLGKMLQIHPKKRITVDEALKHPFMAQLHSEEDEPMAERPFDFSFEDEKLHRIRLQELI
WEEVGDFRPMCLPVPPRRDGSRPPIRRPQRLHYI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcaccactaccagaactactccatgcctaacggtgtgccatctaaacagtat
acccacaacaaccaacatcatcctgtcaaacatcacgctcaccattcctaccaccataac
aacaatcgcatgacagtcgatcaccgtaatgatcacgaagttcgtggctcccactcgtac
gaatcaacacgtaccggacatgcttccttgggcaaggatgatcattccattgccaccgca
acaactgctgccttcacttctcatgcaggcagtcattcatattcgatggatgatggatcc
gtcgcttcggagtatggaacggagattgtcatgaatcgtactcctggatctattcacgga
ggagcgtatggtagattcaagaactcaactccatacagtgctcataccttcaaggctggc
aaccacacctttactgtcgacaccaagtattccttcaaccgagtcattggatcaggtgcc
tacggtgttgtcatctctgcccatgacactcaattaaacacgaaagttgccatcaagatg
gtacccaaagctttccaagatgagattgacgccaaacgtatcctccgcgagatcaagctg
ttgaagcatctcaagcatgagaacattgtgggaattgtggatatgatgccacccatgtat
cgttatgtggacgatttcaatgatgtgtacattgtcagtgagttgatggagaccgatttg
tataggatcatctactcgaagcagagtttgagcattgatcacgtacaatattttatctac
caggtgctgagggcactgaaatacattcattcggcgaatgtgttgcatcgtgatttgaag
ccatctaacttgttggtcaactccaattgtgacttgaaggtgtgcgactttggattagct
cgtggagtgtacggagaggaggagatgaacgagggaaagaagccattattgacggaatat
gttgtaacgaggtggtaccgtgcacctgagattatgcttgcatgccatgaatacgacaag
cctgtggatgtgtggagtactgggtgcatattagctgagcttcttgcgaggaagccatac
tttcctggagaggattacattgatcagctcaccctcattactggaaagcttggcaagctt
cccgaggaagaacttgatttcgttacatccgaaaaggctcgtcgtttcatgaggaagcta
cccaacaaaccagtcgtgcctttgagccaacaattccccgaaaccccaccagaggcattg
gacctcctcggaaagatgcttcaaatccatcccaaaaagagaatcactgtcgacgaagca
ttgaagcatcccttcatggcacaacttcacagtgaggaggacgagcccatggccgaacgc
cccttcgactttagctttgaggatgagaaactgcatcgtattcgtttgcaagagctcata
tgggaggaggttggagacttccgtcccatgtgcctgccagtaccaccaaggagagatggt
tccagaccccctatccgtcgtccccagaggctgcattacatttaa

DBGET integrated database retrieval system