KEGG   Thalassiosira pseudonana: THAPSDRAFT_547Help
Entry
THAPSDRAFT_547    CDS       T01078                                 

Definition
dihydrolipamide s-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_547
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_547
   00020 Citrate cycle (TCA cycle)
    THAPSDRAFT_547
   00620 Pyruvate metabolism
    THAPSDRAFT_547
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     THAPSDRAFT_547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 426 aa AA seqDB search
MPALSSTMKEGKVVSWLKGEGDSVEAGEAIMVVESDKADMDVEAFEDGYIAAIITGEGET
ANVGSPVALIAANEADIPALQAYAATLSGAPAPSAPAAAAPTAAAPVAKAAPKAAAAANP
AASAGGRVVASPLAKKLAEEIGVDITTVVGTGPGGRITAGDVQSASSGGGAAPAKKAAAP
SKPSWTPAPGVIAATPTAPVVEMPEGLVPFTGMQRAVSNNMEATLGCPVFRASREIEMDA
FNACYQSVKPKGVTVSALLAKAVAKAIEKHPIINSSFRPEGTFFNKDINIAMAVSIDGGL
ITPVLKYANERDVLELGENWKELVGKAKSGTLSPDEYNSGTFVISNMGMFGVSQFDAILP
AGLGGILAVAATQEHIVPDKQAVLGMKKISKMTVTLTCDHRQIYGSDAAFFLKTLNDVMN
NPQQLL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccctttcttcaacaatgaaggaaggaaaggttgtttcctggctcaagggagaa
ggagactccgtcgaagccggtgaagccatcatggtcgttgaatccgacaaggctgatatg
gatgtggaagcctttgaggatggatacattgctgccatcattaccggagaaggagagact
gccaatgttggatctcccgtcgctcttattgctgcgaacgaggctgacattcccgctctt
caggcgtacgcagctactctcagtggggcacctgcaccctctgcccccgcagccgctgct
cccacagctgcggcaccagttgccaaggcagcacccaaggctgcggctgctgccaacccc
gccgcctctgctggtggacgtgtcgttgcatctccccttgccaagaagttggcggaagag
attggagttgatatcaccaccgttgttggaactggacctggaggacgtatcactgccgga
gatgtacaaagtgcttcctctggaggtggagccgcacctgccaagaaggctgctgctcca
tcaaagccatcgtggacacctgctcctggagttatcgctgccactcctactgctcccgtt
gtggagatgccagagggacttgttcctttcactggaatgcaacgtgccgtatccaacaac
atggaagctactctcggatgtcctgtcttccgtgctagccgtgagattgagatggatgcc
ttcaatgcttgttaccaatccgtgaagccaaagggtgtgactgtttctgctcttcttgcc
aaggctgtcgctaaggccattgagaagcaccccattatcaacagttcgttcagaccagag
ggaaccttcttcaacaaagatatcaacattgccatggctgtgtctattgatggtggactt
atcactcctgtattgaaatatgccaacgagagagacgtgctagagcttggagagaactgg
aaggaacttgttggaaaggctaagtctggaaccctctcacctgatgagtacaactcgggt
acattcgttatctccaacatgggcatgtttggagtgtctcaattcgatgctattctccct
gctggactcggtggaatccttgccgttgcagcaacacaagaacacattgtgcccgataaa
caagcagttcttggaatgaagaagatctcgaaaatgactgttacactcacatgcgaccac
cgtcaaatctatggatctgatgctgccttcttcttgaagacactgaatgacgtcatgaac
aatcctcagcaattgctttag

DBGET integrated database retrieval system