KEGG   Thalassiosira pseudonana: THAPSDRAFT_547Help
Entry
THAPSDRAFT_547    CDS       T01078                                 

Definition
dihydrolipamide s-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tps01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tps00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tps00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tps00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 426 aa AA seqDB search
MPALSSTMKEGKVVSWLKGEGDSVEAGEAIMVVESDKADMDVEAFEDGYIAAIITGEGET
ANVGSPVALIAANEADIPALQAYAATLSGAPAPSAPAAAAPTAAAPVAKAAPKAAAAANP
AASAGGRVVASPLAKKLAEEIGVDITTVVGTGPGGRITAGDVQSASSGGGAAPAKKAAAP
SKPSWTPAPGVIAATPTAPVVEMPEGLVPFTGMQRAVSNNMEATLGCPVFRASREIEMDA
FNACYQSVKPKGVTVSALLAKAVAKAIEKHPIINSSFRPEGTFFNKDINIAMAVSIDGGL
ITPVLKYANERDVLELGENWKELVGKAKSGTLSPDEYNSGTFVISNMGMFGVSQFDAILP
AGLGGILAVAATQEHIVPDKQAVLGMKKISKMTVTLTCDHRQIYGSDAAFFLKTLNDVMN
NPQQLL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccctttcttcaacaatgaaggaaggaaaggttgtttcctggctcaagggagaa
ggagactccgtcgaagccggtgaagccatcatggtcgttgaatccgacaaggctgatatg
gatgtggaagcctttgaggatggatacattgctgccatcattaccggagaaggagagact
gccaatgttggatctcccgtcgctcttattgctgcgaacgaggctgacattcccgctctt
caggcgtacgcagctactctcagtggggcacctgcaccctctgcccccgcagccgctgct
cccacagctgcggcaccagttgccaaggcagcacccaaggctgcggctgctgccaacccc
gccgcctctgctggtggacgtgtcgttgcatctccccttgccaagaagttggcggaagag
attggagttgatatcaccaccgttgttggaactggacctggaggacgtatcactgccgga
gatgtacaaagtgcttcctctggaggtggagccgcacctgccaagaaggctgctgctcca
tcaaagccatcgtggacacctgctcctggagttatcgctgccactcctactgctcccgtt
gtggagatgccagagggacttgttcctttcactggaatgcaacgtgccgtatccaacaac
atggaagctactctcggatgtcctgtcttccgtgctagccgtgagattgagatggatgcc
ttcaatgcttgttaccaatccgtgaagccaaagggtgtgactgtttctgctcttcttgcc
aaggctgtcgctaaggccattgagaagcaccccattatcaacagttcgttcagaccagag
ggaaccttcttcaacaaagatatcaacattgccatggctgtgtctattgatggtggactt
atcactcctgtattgaaatatgccaacgagagagacgtgctagagcttggagagaactgg
aaggaacttgttggaaaggctaagtctggaaccctctcacctgatgagtacaactcgggt
acattcgttatctccaacatgggcatgtttggagtgtctcaattcgatgctattctccct
gctggactcggtggaatccttgccgttgcagcaacacaagaacacattgtgcccgataaa
caagcagttcttggaatgaagaagatctcgaaaatgactgttacactcacatgcgaccac
cgtcaaatctatggatctgatgctgccttcttcttgaagacactgaatgacgtcatgaac
aatcctcagcaattgctttag

DBGET integrated database retrieval system