KEGG   Thalassiosira pseudonana: THAPSDRAFT_6090Help
Entry
THAPSDRAFT_6090   CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    THAPSDRAFT_6090
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     THAPSDRAFT_6090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_6 DLH Peptidase_S9 Lipase_3 Abhydrolase_3 FSH1 Esterase Esterase_phd Hydrolase_4 AXE1 Abhydrolase_1 DUF2974
Motif
Other DBs
NCBI-GeneID: 7443582
NCBI-ProteinID: XP_002291020
JGI: 6090
UniProt: B8C5I8
Position
6
AA seq 254 aa AA seqDB search
MLLRIKPLFLSAVVPLFITSPRSFIHPTAAMSTANQCDNSKSAIIFLHGLGDSPAGWSSL
ERNLPSLRPKLGDGVHYVFPPAPTISLTINDGMMMPGWFDLYDWPIGINAKDDQEGKLAA
ANVIEETVKRLEEEEGISPSRIIVGGFSQGGAVALLTAYHRRTQGKVPFAGCVCLSGWLT
LKDDLSVTDEVAKSTPLFWGHGQYDDKVLFEQQKHGVDMLKSHGVDVTDRSYPMGHESDY
AELEAMAEFCEKLL
NT seq 761 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcgtatcaagccattgtttctatcagccgtggtaccactttttataacttca
ccacgatcgttcatccaccccaccgccgccatgtccactgccaatcagtgcgacaacagc
aaatcagccatcatcttcctccatggactcggtgattctccggctggatggtcttcactt
gagcgaaatcttccatctcttcgtcctaagcttggtgacggagtgcattatgtctttcct
cctgcacctactatcagtttgacgattaacgatggaatgatgatgccgggatggtttgat
ttgtacgactggcctattggaatcaatgcgaaagatgatcaagaagggaaattggctgct
gctaacgttatcgaggagacagtgaaaagattggaggaggaagagggaatatcgccatca
cgtatcatcgtcgggggattctctcagggaggagctgtcgcactgctcacagcctaccat
cgtcgtacacaaggcaaagttccatttgcaggttgcgtttgtctctcgggatggttgacg
ttgaaggatgatctatcggttaccgacgaagttgcaaaatccactcctttgttctggggg
catggccagtacgacgacaaagttttgtttgagcaacagaagcatggagtggatatgttg
aagagccatggcgtcgatgttactgatcgttcatatcccatgggtcacgagtcggactac
gctgagctcgaagcaatggctgagttctgtgagaagctact

DBGET integrated database retrieval system