KEGG   Thalassiosira pseudonana: THAPSDRAFT_9040Help
Entry
THAPSDRAFT_9040   CDS       T01078                                 

Definition
histone acetyltransferase gcn5-type hat
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THAPSDRAFT_9040
Transfer RNA biogenesis [BR:tps03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    THAPSDRAFT_9040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 552 aa AA seqDB search
MTSSTSYALAISHIVRTLITAYDSSTSLNFTSLKAQAARKYKLSGVPRITDILSSIPVDY
KEKLLPFLRQKPVRTASGVAVVAVMSKPHRCPHIAMTGGVCVYCPGGPDSDFEYSTQAYT
GYEPTSMRAIRARYDPYSQTRGRVAQLRGLGHSVDKVEFIVMGGTFMSLDKSYKDYFIRN
LHDALSGHKSSSVEEAVKYSEHSTIKCIGITIETRPDYCLKPHLSEMLGYGCTRIEIGVQ
SIYESVARETNRGHTVSAVANSFHLAKDCGFKVVTHMMPDLPNTGLERDLTGFSEFFENP
AFRPDGLKLYPTLVIRGTGLYELWKTGRYQNYTPDQLVELTASVMAMVPPWTRVYRIQRD
IPMPLVSSGVEHGNLRELSLARMRDLDLPCKDIRTREVGMKQIQEAVSPDDVELIRRDYV
ANGGWETFLAYEDPEKDILIGLLRLRKASAVAFRPEISEVPSSIVRELHVYGTAVAVSGR
DPTRFQHQGFGMLLMEEAERIAREEHGSEKILVISGVGTRHYYRKMGYELDGPYMSKSLI
LTRSPDYEKVCH
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctccacctcctacgccctcgcaatctcccacatagtccgaaccctaatcaca
gcctacgactcctccacctctctcaacttcacctccctcaaagcccaagcggcccgcaag
tacaagttgtcaggcgtccctcgcatcactgatattttatcgagtatacccgtggattat
aaggagaagttgttgccctttttgaggcagaagcctgtgaggacggcaagtggagtggcg
gttgtggcggttatgagtaagcctcatcggtgtcctcatattgccatgactggaggagtc
tgcgtctactgccccggaggtcccgattcggacttcgaatattcaactcaagcctacaca
ggctatgaaccgacctccatgcgagccatccgtgcccgctacgatccgtactcccaaacg
cggggtcgagtcgcccaacttcgtggcctaggccattccgtggacaaggttgaattcatc
gtgatgggaggtacgttcatgagtttggataagagttacaaggattacttcattaggaat
ttgcatgatgcgttgagtggtcataagagttcgagtgtggaggaggcggtcaagtattcg
gaacatagtactatcaagtgtattgggattacgattgagactcgaccggattattgtttg
aagcctcatttgagtgagatgctggggtatgggtgtacaaggattgaaattggtgtgcag
agtatatatgagagtgtggctcgtgagacgaatagggggcatactgtgagtgcggtggcg
aattcatttcatctggcgaaggattgtgggtttaaggtggtgactcatatgatgccagac
ttaccgaatacggggttggagagggatttgactggatttagtgagttctttgaaaatcca
gcctttcgtcctgatgggttgaagttgtatccaacactggttattcgaggaactgggctt
tacgagttgtggaagactgggaggtatcagaactatacaccagatcagttagtggaactg
acggcaagtgtaatggctatggtaccaccgtggactagggtgtacaggatccagagagat
attccaatgccgttggttagttctggtgtggagcatggtaatctacgtgagttgagtctg
gctcgtatgcgagacttggatttgccgtgcaaggatatacgaacgcgtgaagtaggaatg
aaacaaatccaggaggctgtgagtccagatgatgtggagctgattaggagagattacgtt
gccaacggaggttgggagactttcttggcgtacgaagatcctgagaaggacattctaatt
ggcttattgagattgcgaaaggcgagtgctgtagcattccgtcctgaaatctcagaggtt
ccatcatcaattgttagagagcttcatgtatacggaacagcagtagcagtctccggtcgc
gatccaactcggtttcagcatcaaggatttggaatgttactcatggaggaggcagaacga
attgcgagggaggagcatgggagcgagaaaatacttgtaatctctggtgtgggtacgaga
cattattacagaaagatggggtacgaactcgatggtccttatatgagcaaatcactgatt
ttgacgcgtagtccagactacgaaaaggtttgccattaa

DBGET integrated database retrieval system