KEGG   Thalassiosira pseudonana: THAPSDRAFT_9040Help
Entry
THAPSDRAFT_9040   CDS       T01078                                 

Definition
(RefSeq) histone acetyltransferase gcn5-type hat
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THAPSDRAFT_9040
Transfer RNA biogenesis [BR:tps03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    THAPSDRAFT_9040
Chromosome [BR:tps03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    THAPSDRAFT_9040
   HAT complexes
    Elongator complex
     THAPSDRAFT_9040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 7445803
NCBI-ProteinID: XP_002292996
JGI: 9040
UniProt: B8CA75
Position
12
AA seq 552 aa AA seqDB search
MTSSTSYALAISHIVRTLITAYDSSTSLNFTSLKAQAARKYKLSGVPRITDILSSIPVDY
KEKLLPFLRQKPVRTASGVAVVAVMSKPHRCPHIAMTGGVCVYCPGGPDSDFEYSTQAYT
GYEPTSMRAIRARYDPYSQTRGRVAQLRGLGHSVDKVEFIVMGGTFMSLDKSYKDYFIRN
LHDALSGHKSSSVEEAVKYSEHSTIKCIGITIETRPDYCLKPHLSEMLGYGCTRIEIGVQ
SIYESVARETNRGHTVSAVANSFHLAKDCGFKVVTHMMPDLPNTGLERDLTGFSEFFENP
AFRPDGLKLYPTLVIRGTGLYELWKTGRYQNYTPDQLVELTASVMAMVPPWTRVYRIQRD
IPMPLVSSGVEHGNLRELSLARMRDLDLPCKDIRTREVGMKQIQEAVSPDDVELIRRDYV
ANGGWETFLAYEDPEKDILIGLLRLRKASAVAFRPEISEVPSSIVRELHVYGTAVAVSGR
DPTRFQHQGFGMLLMEEAERIAREEHGSEKILVISGVGTRHYYRKMGYELDGPYMSKSLI
LTRSPDYEKVCH
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctccacctcctacgccctcgcaatctcccacatagtccgaaccctaatcaca
gcctacgactcctccacctctctcaacttcacctccctcaaagcccaagcggcccgcaag
tacaagttgtcaggcgtccctcgcatcactgatattttatcgagtatacccgtggattat
aaggagaagttgttgccctttttgaggcagaagcctgtgaggacggcaagtggagtggcg
gttgtggcggttatgagtaagcctcatcggtgtcctcatattgccatgactggaggagtc
tgcgtctactgccccggaggtcccgattcggacttcgaatattcaactcaagcctacaca
ggctatgaaccgacctccatgcgagccatccgtgcccgctacgatccgtactcccaaacg
cggggtcgagtcgcccaacttcgtggcctaggccattccgtggacaaggttgaattcatc
gtgatgggaggtacgttcatgagtttggataagagttacaaggattacttcattaggaat
ttgcatgatgcgttgagtggtcataagagttcgagtgtggaggaggcggtcaagtattcg
gaacatagtactatcaagtgtattgggattacgattgagactcgaccggattattgtttg
aagcctcatttgagtgagatgctggggtatgggtgtacaaggattgaaattggtgtgcag
agtatatatgagagtgtggctcgtgagacgaatagggggcatactgtgagtgcggtggcg
aattcatttcatctggcgaaggattgtgggtttaaggtggtgactcatatgatgccagac
ttaccgaatacggggttggagagggatttgactggatttagtgagttctttgaaaatcca
gcctttcgtcctgatgggttgaagttgtatccaacactggttattcgaggaactgggctt
tacgagttgtggaagactgggaggtatcagaactatacaccagatcagttagtggaactg
acggcaagtgtaatggctatggtaccaccgtggactagggtgtacaggatccagagagat
attccaatgccgttggttagttctggtgtggagcatggtaatctacgtgagttgagtctg
gctcgtatgcgagacttggatttgccgtgcaaggatatacgaacgcgtgaagtaggaatg
aaacaaatccaggaggctgtgagtccagatgatgtggagctgattaggagagattacgtt
gccaacggaggttgggagactttcttggcgtacgaagatcctgagaaggacattctaatt
ggcttattgagattgcgaaaggcgagtgctgtagcattccgtcctgaaatctcagaggtt
ccatcatcaattgttagagagcttcatgtatacggaacagcagtagcagtctccggtcgc
gatccaactcggtttcagcatcaaggatttggaatgttactcatggaggaggcagaacga
attgcgagggaggagcatgggagcgagaaaatacttgtaatctctggtgtgggtacgaga
cattattacagaaagatggggtacgaactcgatggtccttatatgagcaaatcactgatt
ttgacgcgtagtccagactacgaaaaggtttgccattaa

DBGET integrated database retrieval system