KEGG   Thalassiosira pseudonana: THAPSDRAFT_bd1173Help
Entry
THAPSDRAFT_bd1173 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     THAPSDRAFT_bd1173
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   THAPSDRAFT_bd1173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 282 aa AA seqDB search
MEAEFLSKTKDDEAAKAGTRWTLQDFEIGKPLGRGKFGKVYLARERRTKYIVALKVLSKA
QLLKSGVEHQLRREIEIQAHLRHRHILRMYGYFYDNKNIYLILEYSPGGELYKKLTAKGR
FSERTAARFISDLSLAMKYCHSKHVIHRDIKPENLLLGAKNDVKIADFGWSVHAPTSRRN
TLCGTLDYLPPEMVEGREHDEQVDTWALGVLLYEFLVGVPPFETESHGATYRRIQRVDIR
WPSGMPEDAKDLISKLLKKDPRARLPLECVPKHPFVLRNLRV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgagttcctatccaaaaccaaagacgacgaagccgccaaggcgggaactcgt
tggactcttcaggactttgaaatcggcaaacctctcggacgaggcaagtttggcaaggtc
tacttggcaagggaacgtcgtacaaagtacattgtggcactcaaggtactgtccaaagca
caactgttgaaatcgggagtggagcaccagttgcgtcgtgagattgagattcaggctcat
ttgcgtcatcgtcatattttgaggatgtacggctacttttacgacaataagaacatctac
ctcattctcgaatacagccccggtggagaattgtacaagaagctcactgccaagggtcgc
ttctcggaacgtaccgctgctcgtttcatttcggatctctccttagccatgaagtactgt
cattccaagcacgtcattcatcgtgatatcaagccagagaatctattgttgggtgccaag
aatgatgttaagattgcagactttggatggtctgttcatgctcctacgagtagacgcaac
actctctgtggtaccttggactatttgcccccggagatggtggagggacgtgagcacgat
gagcaagtggatacgtgggctcttggggtgttgttgtacgagtttttggtgggtgtgcct
ccctttgagacggaatcgcatggagcgacatatcgtaggattcaaagggtggatattcgt
tggccgagtggtatgccggaggatgcgaaggatttgattagcaagttgttgaagaaggat
cctagagcgaggttgccgttggagtgtgttcctaagcatccatttgttttgaggaatctc
agggtttag

DBGET integrated database retrieval system