KEGG   Thalassiosira pseudonana: THAPS_10943Help
Entry
THAPS_10943       CDS       T01078                                 

Gene name
DXR1
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tps  Thalassiosira pseudonana
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THAPS_10943 (DXR1)
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     THAPS_10943 (DXR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 482 aa AA seqDB search
MKLSLAFSTILLSQSSAFTTLTSTKSTTTTTSSSLNVFSPPGSAGTGAGWIDPSAPVNTP
ESLQKTLSESLKGSTFQKRISILGSTGSIGTQTLDIVDACPDNFVVDALSAGNNAELMCE
QVLKYKPKVASLGTPEAAKKLKELLVKAGCTDMPEIVHGAEGIVEAATVSTADTVVTGIV
GAAGLLPTIEAIKLGKDIALANKETLISGGPVINPLVEKHGINMLPADSEHSAIFQCLQG
VPPGGLRRVILTASGGAFRDLSKDELFEMCERDPRAVQKKATTHPNWDMGAKITLDSATM
MNKGLEVIEAHYLFGASYDDIDIVIHPQSIVHSMVETQDTSCIAQLGWADMRLPIVYSVS
WPHRLKMPYKPLNLAEIGSLTFKAPDVEKYPCIRLAYEAGRQGGTMTAVLNAANEAANEM
FREDVGLGFLDIPKLIEGAMEAHKEDFKVKDVTLDDILSCDAWAREYVAEQTKNVAKSAL
IL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctctctcgccttctccaccatcctcctcagccagtcctctgccttcaccaca
ctcacctccaccaaatcaacaaccaccaccacatcatcgtcactcaacgttttttctcca
ccaggatccgccggcaccggagcaggctggatcgacccctccgcccccgtcaacacaccc
gaatccctccaaaaaacactctccgaatcactcaaaggatccaccttccaaaaacgcatc
tccatcctcggaagtactggaagcatcggcacacagacgctggatatcgtcgatgcctgt
cctgacaactttgtagtggacgcactgagcgctgggaacaatgccgagttaatgtgtgag
caggttttgaagtacaagcccaaggtagcaagtttgggtacacctgaggcagcgaagaag
ttgaaggaattgctcgtcaaggcgggatgcacggacatgcccgagattgtccatggtgcg
gaaggtattgtcgaagcggcgactgtttccaccgctgatacggttgttactggaattgtc
ggtgcggcgggtctcctaccgacaattgaagcaatcaaattgggaaaggatattgcattg
gcgaacaaagaaacgctcattagtggaggaccggtcatcaaccccctcgttgaaaaacat
ggaatcaacatgctccccgccgatagtgaacatagtgccatattccaatgtcttcagggt
gtaccgcccggcggacttcgtagagtcattttgacggcgagtgggggagcgtttcgtgat
ttgagtaaggatgaattgtttgaaatgtgtgagagggatccgagggcggtgcagaagaag
gctactacgcatcctaattgggatatgggagcgaagattacgttggatagtgctactatg
atgaataaggggttggaggtcatcgaagcacactacctcttcggagcatcctacgacgac
attgacatcgtcatccatccccaatccatcgtccactccatggtcgaaacccaggacaca
tcctgcatcgcccaactaggatgggcagacatgcgtcttccaatcgtctactcagtctcc
tggccccaccgtcttaaaatgccatacaaaccactcaatctagccgaaattggtagtctc
acgttcaaggcaccggatgtggagaagtatccttgtattcgattggcgtacgaggcgggg
aggcagggaggaacaatgacagcggttttgaatgcggcgaatgaggcggcgaatgaaatg
tttagggaggatgtggggttgggatttttggatattccaaagttgattgagggggcgatg
gaagctcataaggaggacttcaaggtgaaggatgtgactttggatgatattttgagttgt
gatgcttgggctagggagtatgttgcggagcagacgaagaatgttgccaagtcggctctt
atattataa

DBGET integrated database retrieval system