KEGG   Thalassiosira pseudonana: THAPS_13647Help
Entry
THAPS_13647       CDS       T01078                                 

Gene name
TMS1
Definition
possible thymidylate synthase (EC:2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tps  Thalassiosira pseudonana
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tps00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tps00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tps00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 516 aa AA seqDB search
VVAAAAGSRGIGHQGKLPWRLPGDMNHFKKVTTTPPSPGLTNAVIMGRKTWDSIPSKFRP
LDGRVNVILSRKSAAGVEGVPMSTDDNNNNNNAEDVLVASSLEEAMQKLDGRANHGSTFI
IGGGEIYSQGIKSGLVKRVIYTNVKGLAEDAKLDAFFPELTDSEWECVPFTPKDNAENEE
TENNHVSKKAKVAEEHEDAKSGLKYEFLEYIRRDNVDIPEGADVNPEEMQYLEICRDIIE
NGVRRGDRTGTGTLSKFGVQMRYSLRDNTLPLLTTKRTFWRGVAEELLWFVKGSTNANEL
ADKNIHIWDGNGSREFLDSRGLQHREEGDLGPVYGFQWRHFGAEYKDMHADYTGQGVDQL
ADCIDKIINNPEDRRIVMSAWNPKDLDVMALPPCHMFCQFYVDTDRNEVSCQMYQRSADM
GLGVPFNIASYALLTHMIAKVTGRKAGDFVHTIGDAHVYLNHVDALKEQLERKPRAFPKL
KMKDGKDFNDIDGFEFDDFEVVGYKPHKTIKMKMAV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gttgtcgcagccgctgccggctctcgcggcattggtcaccagggcaaattgccatggcgt
cttcccggagacatgaaccacttcaaaaaagtcaccaccacccctccctcacccggtctc
accaacgccgtcatcatgggccgcaaaacatgggactctatcccatctaaattccgacca
ctggatggacgtgtcaacgtgatactctctcgtaagagcgctgccggtgtggagggtgta
ccaatgagtactgatgataataataacaacaacaatgcggaggatgtattggttgccagt
tcgttggaggaggcgatgcaaaagctggatggacgtgcgaatcatgggtctacttttatc
attggtgggggagagatttactcccaagggatcaaatctggtttggtcaagagggtgatt
tacactaatgtcaagggtctcgcagaggatgccaagttggatgccttcttccccgaactt
accgatagtgaatgggagtgtgttccttttactcccaaagacaatgccgagaatgaggaa
acggagaataatcatgtgtcgaagaaggccaaggttgcagaggagcacgaggatgcaaag
tctggactcaagtatgagtttttggagtacattcgtcgtgataatgttgatattcctgaa
ggagctgatgttaacccagaggagatgcaataccttgagatttgtcgtgatatcattgaa
aacggtgtgaggaggggagatcgtacggggactggcactctttccaagtttggcgtgcaa
atgaggtattcgttgcgtgataatactttgcctttgttgactaccaagaggacattttgg
aggggggttgctgaggagcttctttggtttgtcaagggttccaccaatgccaacgagctt
gctgacaaaaacattcacatctgggatggcaacggctcccgtgaattcctcgactctcgt
ggtcttcaacaccgcgaagaaggtgacttgggacccgtctacggctttcagtggcgtcat
ttcggtgccgagtacaaagatatgcatgctgattacacagggcagggagtagatcaattg
gctgattgcattgacaagattatcaacaaccccgaggataggaggatcgtgatgagtgct
tggaatccaaaggacttggacgtgatggcattgcctccgtgtcacatgttttgtcagttc
tacgttgatacggaccggaacgaagtctcttgccaaatgtaccaacgttcagctgatatg
ggtctaggagttcctttcaatattgcttcctatgcactgctcactcacatgattgccaaa
gtaaccggacgcaaggccggagactttgttcataccattggagatgctcacgtatacttg
aatcacgttgatgcattgaaggaacagttagagaggaaaccacgtgcatttccaaagtta
aagatgaaggatggaaaggacttcaacgacattgatggatttgagtttgatgattttgag
gtcgttgggtacaagccacacaaaacgattaagatgaagatggctgtg

DBGET integrated database retrieval system