KEGG   Thalassiosira pseudonana: THAPS_13647Help
Entry
THAPS_13647       CDS       T01078                                 

Gene name
TMS1
Definition
possible thymidylate synthase (EC:2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tps  Thalassiosira pseudonana
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    THAPS_13647 (TMS1)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THAPS_13647 (TMS1)
   00670 One carbon pool by folate
    THAPS_13647 (TMS1)
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     THAPS_13647 (TMS1)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     THAPS_13647 (TMS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 516 aa AA seqDB search
VVAAAAGSRGIGHQGKLPWRLPGDMNHFKKVTTTPPSPGLTNAVIMGRKTWDSIPSKFRP
LDGRVNVILSRKSAAGVEGVPMSTDDNNNNNNAEDVLVASSLEEAMQKLDGRANHGSTFI
IGGGEIYSQGIKSGLVKRVIYTNVKGLAEDAKLDAFFPELTDSEWECVPFTPKDNAENEE
TENNHVSKKAKVAEEHEDAKSGLKYEFLEYIRRDNVDIPEGADVNPEEMQYLEICRDIIE
NGVRRGDRTGTGTLSKFGVQMRYSLRDNTLPLLTTKRTFWRGVAEELLWFVKGSTNANEL
ADKNIHIWDGNGSREFLDSRGLQHREEGDLGPVYGFQWRHFGAEYKDMHADYTGQGVDQL
ADCIDKIINNPEDRRIVMSAWNPKDLDVMALPPCHMFCQFYVDTDRNEVSCQMYQRSADM
GLGVPFNIASYALLTHMIAKVTGRKAGDFVHTIGDAHVYLNHVDALKEQLERKPRAFPKL
KMKDGKDFNDIDGFEFDDFEVVGYKPHKTIKMKMAV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gttgtcgcagccgctgccggctctcgcggcattggtcaccagggcaaattgccatggcgt
cttcccggagacatgaaccacttcaaaaaagtcaccaccacccctccctcacccggtctc
accaacgccgtcatcatgggccgcaaaacatgggactctatcccatctaaattccgacca
ctggatggacgtgtcaacgtgatactctctcgtaagagcgctgccggtgtggagggtgta
ccaatgagtactgatgataataataacaacaacaatgcggaggatgtattggttgccagt
tcgttggaggaggcgatgcaaaagctggatggacgtgcgaatcatgggtctacttttatc
attggtgggggagagatttactcccaagggatcaaatctggtttggtcaagagggtgatt
tacactaatgtcaagggtctcgcagaggatgccaagttggatgccttcttccccgaactt
accgatagtgaatgggagtgtgttccttttactcccaaagacaatgccgagaatgaggaa
acggagaataatcatgtgtcgaagaaggccaaggttgcagaggagcacgaggatgcaaag
tctggactcaagtatgagtttttggagtacattcgtcgtgataatgttgatattcctgaa
ggagctgatgttaacccagaggagatgcaataccttgagatttgtcgtgatatcattgaa
aacggtgtgaggaggggagatcgtacggggactggcactctttccaagtttggcgtgcaa
atgaggtattcgttgcgtgataatactttgcctttgttgactaccaagaggacattttgg
aggggggttgctgaggagcttctttggtttgtcaagggttccaccaatgccaacgagctt
gctgacaaaaacattcacatctgggatggcaacggctcccgtgaattcctcgactctcgt
ggtcttcaacaccgcgaagaaggtgacttgggacccgtctacggctttcagtggcgtcat
ttcggtgccgagtacaaagatatgcatgctgattacacagggcagggagtagatcaattg
gctgattgcattgacaagattatcaacaaccccgaggataggaggatcgtgatgagtgct
tggaatccaaaggacttggacgtgatggcattgcctccgtgtcacatgttttgtcagttc
tacgttgatacggaccggaacgaagtctcttgccaaatgtaccaacgttcagctgatatg
ggtctaggagttcctttcaatattgcttcctatgcactgctcactcacatgattgccaaa
gtaaccggacgcaaggccggagactttgttcataccattggagatgctcacgtatacttg
aatcacgttgatgcattgaaggaacagttagagaggaaaccacgtgcatttccaaagtta
aagatgaaggatggaaaggacttcaacgacattgatggatttgagtttgatgattttgag
gtcgttgggtacaagccacacaaaacgattaagatgaagatggctgtg

DBGET integrated database retrieval system