KEGG   Thalassiosira pseudonana: THAPS_263246Help
Entry
THAPS_263246      CDS       T01078                                 

Definition
phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tps  Thalassiosira pseudonana
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    THAPS_263246
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    THAPS_263246
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     THAPS_263246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 437 aa AA seqDB search
MSKPLSEYWINSSHNTYLTGDQLTSRSSVEMYVKALYRGCRCMELDIWDGGKDEFGNPVP
IVYHGHTMTSKILFEDIIKSFQVFLMMHPMTYPIILSLENHCSFPFQQVMAGQLRSILGK
NLYIPDEQSLLGDLPSPSQLRGMVVLKGRRPSGATDDYDTDDDAAADDMTEQQSNLLNSE
YQNDGLDDSVKIAPELAKLTLFHGTKFRTWEESSQTPTYHMHSFSESRVKAFSKSIQCHK
WVEYNQTHMSRAFPSGKRVDSSNYSPILAWSTGCQMVALNFQTPDDPIRINDGRFRENGE
QGYVLKPPSLLSKEETDPRSAMLEVKILSGSCLPKPGGVSFGECIDPYVIVSLFDCHEGK
EVTSSQTTNAVFNNGFSPIWNFEDSFHFQVQNTCVAVMQFAIWDKNPPPKNDEFIASASV
PISCMRQGIRSVQLFDA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagccactctctgagtattggataaactcaagccacaatacctatctgacgggg
gatcagctgacttcacgctccagtgttgagatgtatgtgaaagcattgtatcgaggctgt
agatgtatggagttggatatatgggacggagggaaggatgagtttggtaaccccgtccca
atcgtttaccacggtcacacaatgacgtcaaaaatcttgttcgaagatattattaaatcc
tttcaagtcttcttgatgatgcacccgatgacttatcccataattctctcattagagaat
cactgcagctttccattccagcaagtgatggctggtcagttgcgatcaatattaggaaag
aacttatacatcccagacgagcagtctctgcttggagatcttccttctccatcacaactt
cgaggcatggtggtactgaaaggtaggcgtccgtcaggagcaactgatgactacgataca
gatgacgatgccgcagctgatgatatgacggagcagcaatccaacctcctcaacagtgag
taccaaaacgacgggcttgatgactcagtaaagattgccccagaactagcgaagctaacg
ttgttccacggcacgaagtttagaacatgggaggagagtagccaaacaccaacctatcac
atgcattcctttagcgagtcaagagtgaaggcattcagcaaaagcatccaatgccacaag
tgggttgaatacaatcaaacgcacatgtcacgtgcctttccatcggggaagcgagtagac
tctagcaactatagtccaatcttggcatggtctacaggatgccaaatggttgcactcaac
tttcagactccggacgatcccattcgcatcaacgacggtcgttttcgtgagaacggagaa
caggggtatgtactgaaaccgcccagcttactgtcgaaggaagagacagatccccgttca
gcaatgctcgaggtgaagatccttagcggctcgtgcttgcccaaacccggaggtgtatcg
tttggagaatgtattgatccatacgtcatagtttcattgtttgattgtcacgaggggaag
gaagtgacctcgagccaaacaaccaacgcagtcttcaacaatggattctctcccatttgg
aactttgaggactcctttcacttccaagtgcaaaacacgtgtgtggcagtgatgcaattc
gcaatttgggataagaatcccccaccgaagaatgatgaattcattgcgagtgcatctgta
cctatctcttgtatgaggcagggaatcagaagtgtacaactgtttgatgcc

DBGET integrated database retrieval system