KEGG   Thalassiosira pseudonana: THAPS_263246Help
Entry
THAPS_263246      CDS       T01078                                 

Definition
phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tps  Thalassiosira pseudonana
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tps00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tps04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 437 aa AA seqDB search
MSKPLSEYWINSSHNTYLTGDQLTSRSSVEMYVKALYRGCRCMELDIWDGGKDEFGNPVP
IVYHGHTMTSKILFEDIIKSFQVFLMMHPMTYPIILSLENHCSFPFQQVMAGQLRSILGK
NLYIPDEQSLLGDLPSPSQLRGMVVLKGRRPSGATDDYDTDDDAAADDMTEQQSNLLNSE
YQNDGLDDSVKIAPELAKLTLFHGTKFRTWEESSQTPTYHMHSFSESRVKAFSKSIQCHK
WVEYNQTHMSRAFPSGKRVDSSNYSPILAWSTGCQMVALNFQTPDDPIRINDGRFRENGE
QGYVLKPPSLLSKEETDPRSAMLEVKILSGSCLPKPGGVSFGECIDPYVIVSLFDCHEGK
EVTSSQTTNAVFNNGFSPIWNFEDSFHFQVQNTCVAVMQFAIWDKNPPPKNDEFIASASV
PISCMRQGIRSVQLFDA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagccactctctgagtattggataaactcaagccacaatacctatctgacgggg
gatcagctgacttcacgctccagtgttgagatgtatgtgaaagcattgtatcgaggctgt
agatgtatggagttggatatatgggacggagggaaggatgagtttggtaaccccgtccca
atcgtttaccacggtcacacaatgacgtcaaaaatcttgttcgaagatattattaaatcc
tttcaagtcttcttgatgatgcacccgatgacttatcccataattctctcattagagaat
cactgcagctttccattccagcaagtgatggctggtcagttgcgatcaatattaggaaag
aacttatacatcccagacgagcagtctctgcttggagatcttccttctccatcacaactt
cgaggcatggtggtactgaaaggtaggcgtccgtcaggagcaactgatgactacgataca
gatgacgatgccgcagctgatgatatgacggagcagcaatccaacctcctcaacagtgag
taccaaaacgacgggcttgatgactcagtaaagattgccccagaactagcgaagctaacg
ttgttccacggcacgaagtttagaacatgggaggagagtagccaaacaccaacctatcac
atgcattcctttagcgagtcaagagtgaaggcattcagcaaaagcatccaatgccacaag
tgggttgaatacaatcaaacgcacatgtcacgtgcctttccatcggggaagcgagtagac
tctagcaactatagtccaatcttggcatggtctacaggatgccaaatggttgcactcaac
tttcagactccggacgatcccattcgcatcaacgacggtcgttttcgtgagaacggagaa
caggggtatgtactgaaaccgcccagcttactgtcgaaggaagagacagatccccgttca
gcaatgctcgaggtgaagatccttagcggctcgtgcttgcccaaacccggaggtgtatcg
tttggagaatgtattgatccatacgtcatagtttcattgtttgattgtcacgaggggaag
gaagtgacctcgagccaaacaaccaacgcagtcttcaacaatggattctctcccatttgg
aactttgaggactcctttcacttccaagtgcaaaacacgtgtgtggcagtgatgcaattc
gcaatttgggataagaatcccccaccgaagaatgatgaattcattgcgagtgcatctgta
cctatctcttgtatgaggcagggaatcagaagtgtacaactgtttgatgcc

DBGET integrated database retrieval system