KEGG   Thalassiosira pseudonana: THAPS_30380Help
Entry
THAPS_30380       CDS       T01078                                 

Gene name
TPI2
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tps01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tps01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tps00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tps00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tps00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:tps00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 276 aa AA seqDB search
MSFSSACKRPSGSSKGTPAPEGERKYLIGGNWKCNGTIASLEKIISEFNAAGPIPANAEV
VIGCPAMHIPIALMSLRDDIEIAAQNCSLTGCGAYTGEIAASQLKDMGVTWVILGHSERR
EGFGMAGEDSELVAKKTKKAIEEGLKVMFCIGEKKEEREAGTTMDVCASQLKPAADILSK
EDWANVSIAYEPVWAIGTGLTATPEMAQETHANIRAWVAENVGQDVADAVRIQYGGSMKG
ANAADLLAQADIDGGLIGGASLTMDFFNCVNGVPSP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcttctgcctgcaaacgcccctctggctcctccaagggcactcccgccccc
gaaggcgaacgcaagtacctcatcggcggcaactggaagtgcaacggaaccatcgcctcc
cttgaaaagatcatctctgaattcaacgctgccggccccatccccgccaacgccgaggtg
gtcatcggatgccctgccatgcacattcccatcgccctcatgtccctccgtgacgatatc
gaaattgccgctcagaactgcagccttaccggatgcggagcttacactggcgaaattgcc
gcttctcaactcaaagatatgggtgtgacgtgggtgattcttggacattcggagcgtcgt
gagggatttggaatggctggcgaggatagcgagttggtggccaagaagacgaagaaggcc
attgaggaggggttgaaggtcatgttctgtatcggcgagaagaaggaggagagggaggcg
ggtactaccatggatgtttgtgccagtcagttgaagcctgctgctgatattcttagcaag
gaggattgggccaacgtttccattgcctacgaaccagtatgggcaatcggaaccggcctc
accgccacccccgagatggcacaagaaacgcacgccaacatccgtgcttgggtggccgag
aacgttggacaggatgttgccgacgctgttcgtatccaatacggtggaagtatgaaggga
gcaaatgccgctgatcttttggcccaggctgatatcgatggaggtcttatcggaggtgct
tccttgactatggacttctttaactgtgtcaacggtgttccctctccttaa

DBGET integrated database retrieval system