KEGG   Thalassiosira pseudonana: THAPS_30380Help
Entry
THAPS_30380       CDS       T01078                                 

Gene name
TPI2
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPS_30380 (TPI2)
   01230 Biosynthesis of amino acids
    THAPS_30380 (TPI2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPS_30380 (TPI2)
   00051 Fructose and mannose metabolism
    THAPS_30380 (TPI2)
   00562 Inositol phosphate metabolism
    THAPS_30380 (TPI2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    THAPS_30380 (TPI2)
Enzymes [BR:tps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     THAPS_30380 (TPI2)
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   THAPS_30380 (TPI2)
  Exosomal proteins of bladder cancer cells
   THAPS_30380 (TPI2)
  Exosomal proteins of melanoma cells
   THAPS_30380 (TPI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 276 aa AA seqDB search
MSFSSACKRPSGSSKGTPAPEGERKYLIGGNWKCNGTIASLEKIISEFNAAGPIPANAEV
VIGCPAMHIPIALMSLRDDIEIAAQNCSLTGCGAYTGEIAASQLKDMGVTWVILGHSERR
EGFGMAGEDSELVAKKTKKAIEEGLKVMFCIGEKKEEREAGTTMDVCASQLKPAADILSK
EDWANVSIAYEPVWAIGTGLTATPEMAQETHANIRAWVAENVGQDVADAVRIQYGGSMKG
ANAADLLAQADIDGGLIGGASLTMDFFNCVNGVPSP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcttctgcctgcaaacgcccctctggctcctccaagggcactcccgccccc
gaaggcgaacgcaagtacctcatcggcggcaactggaagtgcaacggaaccatcgcctcc
cttgaaaagatcatctctgaattcaacgctgccggccccatccccgccaacgccgaggtg
gtcatcggatgccctgccatgcacattcccatcgccctcatgtccctccgtgacgatatc
gaaattgccgctcagaactgcagccttaccggatgcggagcttacactggcgaaattgcc
gcttctcaactcaaagatatgggtgtgacgtgggtgattcttggacattcggagcgtcgt
gagggatttggaatggctggcgaggatagcgagttggtggccaagaagacgaagaaggcc
attgaggaggggttgaaggtcatgttctgtatcggcgagaagaaggaggagagggaggcg
ggtactaccatggatgtttgtgccagtcagttgaagcctgctgctgatattcttagcaag
gaggattgggccaacgtttccattgcctacgaaccagtatgggcaatcggaaccggcctc
accgccacccccgagatggcacaagaaacgcacgccaacatccgtgcttgggtggccgag
aacgttggacaggatgttgccgacgctgttcgtatccaatacggtggaagtatgaaggga
gcaaatgccgctgatcttttggcccaggctgatatcgatggaggtcttatcggaggtgct
tccttgactatggacttctttaactgtgtcaacggtgttccctctccttaa

DBGET integrated database retrieval system