KEGG   Thalassiosira pseudonana: THAPS_41333Help
Entry
THAPS_41333       CDS       T01078                                 

Definition
WD-40 repeat containing protein
Orthology
K14298  
mRNA export factor
Organism
tps  Thalassiosira pseudonana
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tps03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 363 aa AA seqDB search
MSFGVAAAQTPQLVGSCTAGRAASATPNDHSVAQAGNDGITSVIWSPTANNLVSTNWDGG
VRCWEVQESAGQVRAMPKAQVNHENNSPVLDSCFSPDGTTVFSVGADKAVRMWQLGQTPT
NNVPQQIGAHDQPIKSVAFLPSTNMIVSGGWDNMLKFWDARQPNPVGSLQMPDKVYDLDV
RDSLMVVACAGRHIITYNVQGQPQEHERKESPLKFQSRCVAAFPDATGYAVGSIEGRVGI
QYVTKVPGKESFAFKCHRDQSKVFPVNNICFHKQFGTFATVGGDGIINFWDKDNKQRLKG
FPAIHRTITCANFSAQGNLFAYASSYDWHKGSSGYAPGTPNEIWVHSVQEEEIKPKAKKT
GYR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttggagtagccgccgcacaaaccccccaactagtaggctcctgcacagccgga
agagccgcctccgccacccccaacgaccacagtgtcgcccaggcaggcaacgacggcatc
acctctgtcatttggagtccgacggcgaacaacttggtgtccactaattgggatgggggt
gtgcgatgttgggaggttcaggagagtgcggggcaggttagagctatgcccaaggctcag
gtcaaccacgaaaacaattctcccgtcctcgactcctgcttctcccccgacggcaccaca
gtcttctccgtaggcgctgacaaggccgtgcgaatgtggcaacttggacaaactcccacc
aacaacgttccccaacaaattggagcacacgatcaacccatcaaatctgtagcgttccta
ccttccactaacatgattgtatcagggggctgggataatatgctgaaattttgggacgcg
aggcaacccaatccggtgggatcactgcagatgccggataaggtgtatgatttggatgta
cgtgatagtttgatggtggtggcttgtgcggggaggcacatcattacttataacgtgcag
ggtcaaccgcaggaacatgagaggaaggagagtccgttgaagtttcagagtcgatgtgtg
gctgcctttccggatgctactggttatgccgtggggagtatcgagggcagggttggcatc
caatacgtgacaaaagttcccggaaaagagtcctttgcattcaaatgccatcgtgaccaa
tcaaaagtctttcccgtcaacaatatttgcttccacaaacaattcggcacctttgcaacc
gtgggaggagacgggatcatcaatttttgggacaaggataacaaacagaggctcaaggga
ttcccagccattcaccgaacaatcacatgtgccaatttcagtgctcaggggaatttgttt
gcgtatgcgagtagttatgattggcacaagggaagttcgggttatgctcctgggactccg
aatgagatttgggttcacagtgtgcaggaggaggagattaagccaaaggcaaagaagact
ggttacagataa

DBGET integrated database retrieval system