KEGG   Thalassiosira pseudonana: THAPS_42804Help
Entry
THAPS_42804       CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     THAPS_42804
Peptidases [BR:tps01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   THAPS_42804
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THAPS_42804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 518 aa AA seqDB search
MKLQTTFIASILASSSSITSFTYAQSIRGSSSTDKAVNTQRDLYPSKDSRIIGGSEASSG
RYSYTVSIQDNLGHFCGGSLIAKDVVLTAAHCQGGPYKVVIGRHDLGESSGDVIDMKREL
PHPKYNDRTTDNDFNLVFLDRPTTANVEMVTLNSQSSLPGVGDEVTVVGWGDTVAADDVQ
RLSDKLMEVEVNVISNQECDASEGEIGGWYDTYKNQITKNMLCANDKNQDSCQGDSGGPL
VIKGNGASGEGDVQVGVVSWGIGCASQHFPGVYARVDTAYDWIREEVCKGSGYAPASFAC
SGSVQVDGSSGNNNNNNNNGSGSGSGSGNGKPDKPNKPNKPMAEGFVNNGSNINSSSSSS
SIASSSNGNWNTLYTENFLNGFGIFRKGGSDAKHYIFLKKRDGVARIQGGNGMQSSIYSD
ALDMGKSYSKLRVVFSFFALGMEDNDSFCLDSSTDGGNTWSEEQCWESNDIRNKVWNDDE
AVEFGVSNASSVSIRFRCNGSDRKDDVLISYVEIQGLP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcaaaccactttcatcgcctccatcttggcatcatcatcgtccatcacatca
ttcacatacgctcaatccatcagaggtagcagcagcaccgacaaggctgtcaacactcaa
cgtgatctctatccatcaaaagacagccgcatcatcggaggctcagaggcatcttctggt
agatattcctacaccgtttccatccaagataacctcggacatttctgcggtggctctctc
attgccaaagacgtagtactcacggcagcacactgtcaaggaggcccttacaaggtagtc
attggacgtcacgatcttggtgaaagcagtggcgatgtgattgacatgaagcgagagctg
cctcatccaaagtacaacgacagaactaccgacaacgacttcaacttggtctttcttgat
cgtccaaccacggctaatgtggagatggtgactttgaactcacaatcgtctcttcctgga
gttggagatgaagtaaccgtcgtggggtggggtgacactgtggctgctgatgacgtacaa
aggctgagtgataaactcatggaggtggaagtgaatgtgatttccaaccaagaatgtgat
gccagtgaaggagagattggaggatggtacgacacgtacaagaaccaaatcacaaagaac
atgttgtgtgccaatgataagaatcaggatagttgtcaaggtgattcaggcggtccgttg
gttatcaaaggcaacggagcatcgggcgaaggcgatgtacaggttggcgtcgtgtcttgg
ggtatcggctgtgcatctcagcatttccccggtgtgtatgctcgtgttgatactgcctat
gattggattcgcgaggaggtatgcaaaggaagtggatatgctcctgcctcatttgcgtgt
agcggaagtgtgcaggtggatggcagcagtggtaacaacaacaacaacaacaacaacgga
agtggaagtggaagtggaagtggaaatggcaagcctgataagccaaacaaacccaataaa
ccaatggcagaaggctttgtcaacaacggcagcaacatcaacagcagcagcagcagcagc
agcatcgccagcagcagcaacggaaactggaatacactttataccgagaacttcttgaat
ggattcgggatcttcaggaaaggaggcagcgatgccaagcactacatattccttaaaaag
agagacggtgtagctcgcatccaaggagggaacggaatgcagtcatccatttactcggat
gcattggacatgggaaaatcctactccaagttgcgggtagttttttcctttttcgcactc
ggtatggaagacaatgatagcttctgcttggactcaagcactgacggaggaaatacttgg
tcggaggagcaatgctgggagagcaatgacattagaaacaaagtgtggaacgatgacgag
gctgtggagtttggagtgtccaatgctagtagtgtgagtattcgcttcagatgcaatgga
agtgataggaaagatgatgtgctcattagttatgttgagattcagggactgccgtag

DBGET integrated database retrieval system