KEGG   Thalassiosira pseudonana: THAPS_6770Help
Entry
THAPS_6770        CDS       T01078                                 

Gene name
ACC
Definition
acetyl-coa carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tps  Thalassiosira pseudonana
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tps01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tps00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tps00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:tps00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 2088 aa AA seqDB search
MAPRRYAVAAAALLASASVTAFAPQQSAFTPQALTSSPNRNIFGALKSAFFPNNDVATST
SLWAATLDETTASSSSSGTTQTVEEYVKARGGNRPIRKVLIANNGMAATKSILSMRQWAY
MEFGDERAIQFVAMATPEDLKANAEFVRLADSFVEVPGGKNLNNYANVDVITKIAQEQGV
DAVWPGWGHASENPKLPNTLDKMGIKFIGPTGPVMSVLGDKIAANILAQTAKVPSIPWSG
SFGGPDDGPLQANLNAEGTIPQEIFEKGLVRSADEAVVAANKIGWENGIMIKASEGGGGK
GIRFVDNEADLRNAYVQVSNEVIGSPIFLMQLCKNARHIEVQIVGDQHGNAVALNGRDCS
TQRRFQKIFEEGPPVIVPPETFHEMELAAQRLTQNIGYQGAGTVEYLYNAATNEYYFLEL
NPRLQVEHPVTEGITYANLPATQLQVAMGIPLSNMPDIRRLYGREDPYGTDPIDFLQERY
RELKEHVIAARITAENPDEGFKPTSGSIERIKFQSTPNVWGYFSVGANGGIHEFADSQFG
HLFAKGPNREQARKALVLALKEMEVRGDIRNSVEYLVKLLETDDFKQNTIDTSWLDGIIK
EKSVTVDVPSHLVVVSAAVFKAFEHVKDATEEVKESFRKGQVSTGGIPGINSFNVEVAYM
DTKYPFHVERISPDVYRFTLDGNTIDAEVTQTAEGALLATFGGETHRIFGMDEPLGLRLS
LDGNTILMPTIFDPSELRTDVTGKVVRYLQDNGAPVESGQPYVEVEAMKMIMPIKATESG
KITHNLSPGSVISAGDLLASLELKDPSKVKKIETFEGSLDIPASSVDIDAQKAVMNVLAG
FNMDPEAVAQRAFDSVTDSTGAADLLISSMEEFYRVESQFENDIADDVVRALTKANADNL
DIVISENLAHQQLSLRTQLLLAMIRQLDTFSDRFGSAVPDAVIEALDKISGLKGKAYGEI
ILAAEEKVREAKVPSFDVRRADLRAKLVDSETDLEELAKSSTLSAGVDLLTNLFDDEDAS
VQAAALEVYTRRVYRTYTVPELTVGDVDGRLSCSYAFQFSDVPAKDRVTRYGFLSVIKDA
GNFAKELPEILSSFGSKLSGDAGKDGPVNVLQVGALSGDISVGDLEKAIAANKDKLNMLG
IRTVTALITRGKKDPSYYSFPQCNGFKEDPLRRGMRPTFHHLLELGRLEENFDLERIPAV
GRNVQIYVGSEKSARRGAAKVVFVRGITHTPGLTTVSGARRALLQGLDELERAQANSKVD
IQSSSRIFLHSLPELSGSTPEEIAKEFDVVVDKLKSRLAKRLLKLRVDEIEAKVRVTSTD
EDGNPMVVPVRLVASSMEGEWLKSAAYVERPDPVTGVTREFCVIGDGKDSVCMLDPYASS
NIIQTKRAIARRVGSTYAYDYLGLIEVGLIGEWETYLDSLSGPNAPTIPTNVFDARELIE
GANGELVLGSREIGTNKVGMVAWVVTMKTPEYPEGREVVFISNDITVQSGSFGVAEDEVF
FKASKYAREHKLPRVYISCNSGARIGLVEDLKPKFKIKFVDEASPSKGFEYLYLDDETYK
TLPEGSVNVREVPEGWAITDIIGTNEGIGVENLQGSGKIAGETSRAYDEIFTLSYVTGRS
VGIGAYLVRLGQRVIQMKQGPMLLTGYGALNKLLGRGVYNSNDQLGGPQVMYPNGCSHEI
VDDDQQGVQSIIQWLSFVPKTTDSISPVRECADAVNRDVEFRPTPTPYDPRLMLTGTDDE
AGFFDKGSFKEYLGGWGKSVVIGRGRLGGIPMGAISVETRLVEKIVPADPADPNSREAVL
PQAGQVLFPDSSYKTAQALRDFNNEGLPVMIFANWRGFSGGSRDMSGEILKFGSMIVDAL
REYKHPIYIYFPPHGELRGGSWVVVDPTINEEKMTMFSDPDARGGILEPAGIVEIKFRVA
DQLKAMHRIDPQLQMLDAELDATDDTDASAQDAIKEQIAAREELLKPVYLQAATEFADLH
DKTGRMKAKGVIKEAVPWARSREYFFYLAKRRIAQDNYVSQLKAADSSLDTNGALDILKG
MCSADWEDNNAVLEYYSANDAAITTKISEMKTASIKAKIEALQKELGE
NT seq 6267 nt NT seq  +upstreamnt  +downstreamnt
atggctccgagaaggtatgctgttgcagcagctgccttgttggcatctgcatcggtgact
gcgtttgctccccagcaatcagccttcactcctcaagctctcacctcctcacccaaccgc
aacatctttggtgcactcaaaagtgctttcttcccaaacaacgatgtcgccacctccacc
tccctctgggcagccaccctcgatgaaaccaccgcctcatccagctcctccggaaccacc
caaactgtggaagaatacgtcaaagcccgtggaggaaaccgtcccatccgcaaagtcctc
attgccaacaacggtatggctgcgactaaatccatcctatccatgcgtcaatgggcatac
atggaattcggagacgagcgtgccatccaattcgttgccatggccactcccgaagatctc
aaggcgaatgctgagtttgtccgtcttgccgattcgttcgtggaagttcctggtggaaag
aacttgaataactatgccaatgtcgatgttattacgaaaattgctcaggagcagggagtg
gatgccgtctggcctggatgggggcatgcttcggagaatcccaagcttcctaacactctt
gacaagatggggatcaaattcattggacctactgggccagtcatgagtgtgttgggagat
aagattgctgccaacatcttggctcagacggcgaaagttccctccatcccttggagtgga
tcgtttggaggacctgacgatgggcctctacaggctaacttgaatgcagagggtactatt
ccccaggagatatttgagaagggattggttcgttcggctgatgaagctgtcgttgccgca
aacaaaattggatgggagaatggtatcatgattaaggcctccgagggagggggcggaaag
ggaatccgtttcgttgataacgaggctgatttgcgcaatgcctacgtccaagtctccaat
gaggttatcggatctcccatcttcctcatgcagttgtgtaagaacgctcgtcacattgaa
gttcagattgttggagatcagcacggcaacgccgttgccttaaacggtcgtgattgttcc
acccagcgtcgtttccagaaaatctttgaggagggtcctcctgtgatcgtccctcctgag
actttccatgagatggaattggctgcacagcgtcttactcaaaacattggataccaaggt
gctggaactgttgagtacttgtacaatgctgccaccaacgagtactacttccttgagttg
aacccacgtcttcaagtggagcatcctgttactgaggggatcacctatgccaatcttcct
gccacccagcttcaagttgccatgggaattcctttgagcaacatgcctgatatccgtcgt
ctttacggaagggaagacccctatggcactgatcctatcgactttcttcaggaacgttac
cgtgaactcaaagagcacgttattgctgctcgtatcactgctgagaaccccgatgaagga
ttcaagcctacttcgggatcgattgagcggatcaagttccagtctactcccaatgtttgg
ggatacttctctgttggagccaacggtggtattcacgagtttgccgattctcagtttggt
cacttgttcgccaagggtccaaaccgtgaacaggctcgcaaggcattggttttggcactc
aaagagatggaagttcgcggtgacattcgtaactctgttgaatacttggtcaaattgttg
gagactgatgactttaagcagaacaccattgatacttcttggttggatggaatcatcaaa
gaaaagtccgtgactgtagacgtgccttcgcaccttgtcgttgtttcggctgctgtattc
aaggcatttgagcacgtcaaggatgccactgaagaggtcaaggagtcattccgtaagggg
caagtttcaaccggtggtattccaggaattaactccttcaatgtcgaagttgcttacatg
gataccaagtaccccttccacgttgagaggatctcgcctgatgtttacagatttactcta
gatggcaacaccattgatgctgaagtgacacaaactgctgagggtgctttgttggctact
tttgggggagagactcatcgtatcttcggaatggacgagccccttggtttgaggctgtcg
ttggacggaaacaccattctgatgcctaccatttttgatccatctgaacttcgtactgac
gttaccggaaaggttgttcgttacctccaagacaatggtgcccctgttgaatctggccag
ccttacgtggaagtagaagcaatgaagatgattatgcccattaaagccaccgagtctgga
aagatcacccacaacctcagtcctggatctgttatctccgccggtgacctgcttgcctct
cttgagttgaaggatccttccaaggtgaagaagattgagacctttgagggatctcttgac
attcctgcatccagcgttgatattgatgcccagaaggccgtcatgaatgtacttgccgga
ttcaacatggatcccgaggcagttgctcagcgagcctttgacagtgttactgacagtact
ggagccgccgatcttctcatcagttctatggaagagttctatcgcgttgaatctcagttt
gagaatgacatcgctgatgatgttgttcgtgctctcaccaaagcgaatgccgacaacctt
gatatcgtcatttccgagaacttggcccaccaacaactttccttgcgcactcagctcctc
cttgccatgatccgccagttggataccttctcggataggttcggaagtgcggtgcctgat
gccgtgattgaggctcttgataagatttctggattaaaaggaaaggcatacggtgaaatc
attcttgctgcggaagagaaagtccgcgaggctaaggtgccttcctttgatgtgcgtcgt
gccgacttgcgcgccaagcttgtggattctgaaaccgacttggaggaacttgccaagagc
tccactctttcggctggtgttgaccttctcaccaaccttttcgatgacgaagatgcttcc
gttcaggctgctgccttggaggtgtacacccgtcgtgtctaccgtacctacactgtgcct
gagttgaccgttggagatgttgatggccgtctatcatgcagctacgcattccagttctct
gatgttcctgccaaagatcgcgtgactcgttacggattcttgtctgttattaaggatgcc
ggcaactttgccaaggagttgcccgaaatcctcagttctttcggttccaagctttctgga
gatgctggcaaggatggacctgtgaacgtgttgcaggttggtgctctctccggagatatc
agcgtgggagatcttgagaaagcaatcgcagccaacaaagacaagctcaacatgctcgga
attcgtaccgttactgctctcatcaccaggggaaagaaggaccccagttactactccttc
cctcagtgcaacggcttcaaggaggatcctcttcgtcgtggcatgcgccctactttccac
caccttctcgagttgggacgtcttgaggagaactttgatcttgagcgtattcctgccgtt
ggacgcaatgtgcaaatctatgttggctctgagaagtctgccaggcgtggtgctgccaag
gtggtctttgtgcgtggaattacccacactcctggccttactaccgtttctggtgctcgt
cgtgccttgcttcagggtcttgacgaattggagcgtgctcaggccaactccaaggttgat
atacagtcgtcttctcgaatcttcttgcattctcttcctgaactttctggatctactcct
gaagaaattgcgaaggagtttgatgtcgtcgttgataagctcaagagtcgtttggctaag
cgtttgttgaagctgcgtgttgatgagattgaggccaaagtccgtgttacttcaactgac
gaggatggcaatccaatggttgttccagtgcgtcttgttgcttcgtcgatggagggcgaa
tggctcaagagtgctgcttacgttgaacgtcccgaccctgtcactggagtcactcgtgaa
ttctgcgtcattggagatggaaaggactctgtctgcatgcttgacccttacgcctcgtcc
aacatcatccagaccaaacgtgccatcgcccgtcgtgttggctctacctatgcttatgac
tacctcggacttattgaggttggattgattggagagtgggagacctaccttgatagcctt
tctggacccaacgctcctactatccccaccaacgtatttgatgctcgtgagcttattgag
ggcgccaacggagagcttgttctcggaagccgtgagattggaaccaacaaggtgggcatg
gttgcttgggttgtcaccatgaagactcccgaataccctgagggacgtgaggttgtcttc
atctccaatgacataactgttcagagtggatcgtttggagttgccgaggatgaagtcttc
tttaaggcatccaagtatgctcgtgagcacaaacttccacgtgtgtacatttcctgtaat
tctggagccaggattggattggttgaggacctcaaaccaaagttcaagatcaagtttgtc
gacgaggcaagcccatccaagggatttgagtatctttaccttgacgacgaaacttacaag
accttgcctgagggatccgtgaatgtgagggaggttcctgagggatgggccatcactgat
atcattggaaccaacgagggcattggtgttgagaatcttcaaggaagtggaaagatcgcc
ggagagacttccagggcttatgacgagatcttcacattgagttatgttactggtcgcagt
gttggaattggagcctaccttgtccgtcttggtcagcgtgttatccaaatgaagcaggga
cctatgcttctcactggttacggtgcattgaacaaactccttggacgtggcgtgtacaac
tcaaatgatcaacttggaggtccacaggtcatgtaccccaacggttgctctcacgaaatc
gtcgacgatgatcagcagggtgtgcaatccatcattcagtggctcagttttgtccccaag
actactgattctatctcacctgttcgtgaatgcgctgatgctgtcaaccgtgacgtcgaa
ttccgtcctacacccactccatacgatcctcgtctcatgctcactggaactgacgacgaa
gctggattctttgataagggaagtttcaaggagtacttgggtggatggggaaagagtgtt
gtcattggacgtggacgtcttggaggtattcccatgggtgccatctctgttgagactcgt
ctcgtcgagaagattgtgcctgctgatcctgccgatcccaactctcgtgaggccgtcctt
cctcaggctggacaggttcttttccctgattcttcttacaagactgctcaagctcttcgt
gacttcaacaacgagggcttgcctgtgatgatctttgccaactggcgtggattcagtgga
ggaagtcgtgatatgtctggcgagattctcaagttcggatccatgatcgttgacgctctt
cgcgagtacaagcacccgatctatatttacttccctcctcatggagaacttcgtggagga
tcatgggttgtggttgaccctaccatcaatgaggagaagatgaccatgttctctgatcct
gatgctcgtggtggtatccttgagcctgcaggtattgttgagatcaagttccgtgtggcc
gatcaactcaaggccatgcaccgtatcgatcctcaactccagatgcttgatgccgagctt
gacgcaactgatgacactgatgcttctgcccaggatgctatcaaggagcagattgcagca
agggaggaactcctcaaaccagtgtaccttcaggccgccaccgagtttgccgacctacac
gacaagaccggaaggatgaaggccaagggagttatcaaggaggcagttccatgggccaga
tctcgcgagtacttcttctacctcgccaagcgccgcattgctcaagataactacgtctcg
cagctcaaggctgctgattcgtcgttggataccaacggggctcttgacattctcaagggt
atgtgctctgctgattgggaggacaacaatgctgtgcttgagtactactctgccaatgat
gctgccatcactaccaagataagcgagatgaagactgcttccatcaaagcgaagattgaa
gcactccaaaaggagttgggagagtaa

DBGET integrated database retrieval system