KEGG   Thermotoga petrophila: Tpet_0007Help
Entry
Tpet_0007         CDS       T00525                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00010  Glycolysis / Gluconeogenesis
tpt00350  Tyrosine metabolism
tpt00625  Chloroalkane and chloroalkene degradation
tpt00626  Naphthalene degradation
tpt01100  Metabolic pathways
tpt01110  Biosynthesis of secondary metabolites
tpt01120  Microbial metabolism in diverse environments
tpt01130  Biosynthesis of antibiotics
tpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpet_0007
  Lipid metabolism
   00071 Fatty acid degradation
    Tpet_0007
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tpet_0007
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tpet_0007
   00626 Naphthalene degradation
    Tpet_0007
Enzymes [BR:tpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tpet_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABQ46036
JGI: Tpet0007
UniProt: A5IIL3
Position
complement(6507..7586)
Genome map
AA seq 359 aa AA seqDB search
MWEFYMPTDVFFGEKILEKKGSIIDILGKRALVVTGKSSSKKNGSLDDLRKLLNETGISY
EIFDEVEENPSFDNVMKAVERYRNDSFDFVVGLGGGSPMDFAKAVAVLLKEKDLSVEDLY
DREKVKHWLPVVEIPTTAGTGSEVTPYSILTDPEGNKRGCTLMFPVYAFLDPGYTYFMSD
KLALSTGVDALSHAVEGFLSRKSTPPSDALAIEAMKIIHRNLPKAIEGNREARKKMFVAS
CLAGMVIAQTGTTLAHALGYPLTVEKGIKHGKATGMVLPFVMEVMKEEIPEKVTTVNHIF
GGSLLRFLKELGLYEKVTVSSEELEKWVEKGSKAKHLTNTPGTFTPEKIRNIYREALGV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaattctacatgcccacagatgtcttttttggagaaaagatcctcgaaaaaaaa
ggaagcataatagatattcttggaaaaagggccctggtggtgaccggtaaatcttcttcg
aagaagaatggatcccttgatgatctgagaaagcttctcaacgaaacaggaatatcctac
gagattttcgatgaagtcgaggagaatccgtctttcgataacgtcatgaaagctgttgag
aggtacagaaacgattctttcgattttgtcgtgggactcggtggaggaagtccaatggat
ttcgccaaagcggtggccgtgcttttgaaagaaaaagatctttccgttgaagatctgtac
gatagagaaaaagtgaagcactggcttccagttgtggagataccgaccaccgccggaacg
ggtagtgaggtcacgccgtattccattctcaccgatccagaaggaaacaaaagaggttgt
acactcatgttcccggtgtacgcgtttctcgatcccggatacacctatttcatgtctgat
aaactggctctgtcaactggagttgatgcgctttcccacgcggtcgagggattcctctcc
agaaagagcacaccgccctctgatgccctcgcgatcgaagccatgaagataatacacagg
aatttaccgaaggccattgaaggaaacagagaagccagaaagaagatgttcgtggcctcc
tgccttgctggaatggtgattgcgcaaactggaaccacattggcgcacgctctgggttat
cctctgacagtggagaagggaataaaacacggaaaggcgacaggtatggtgctcccgttt
gtcatggaagtaatgaaagaagaaattccagaaaaagtgaccacggtgaaccacatattc
ggtggcagtcttttgagatttctgaaagagcttgggctttatgaaaaagtaacagtctcc
tctgaagaactggagaagtgggtcgaaaagggttccaaagcgaaacacttgaccaacaca
cctggtactttcactcccgagaagatcagaaacatatacagggaggccctcggggtgtga

DBGET integrated database retrieval system