KEGG   Thermotoga petrophila: Tpet_0226Help
Entry
Tpet_0226         CDS       T00525                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tpt  Thermotoga petrophila
Brite
Enzymes [BR:tpt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tpet_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(221098..222051)
Genome map
AA seq 317 aa AA seqDB search
MREKLFWILKKYGVSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQ
PSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNV
ERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLS
RRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLREFPFNREILLVRSHIF
VELVDLLTRRLTEIDGTFYYAGPNGVVEFLDDRMRIYGDAPEIENLLTQWESCGYRSFEY
LMLHVGYNAFSHISCSI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaagctcttttggattcttaaaaagtacggtgtgagcgatcacatcgcgaag
gcttttctggaaataccccgtgaggagttcctgacgaagtcctacccactctcttacgtt
tacgaggatatcgttctggtttcctacgatgatggagaagaatacagcacttccagtcag
ccctctttgatggcgctgtttatggagtgggtgggtctggacaaaggaatgagagtcctc
gaaataggcggaggaacgggttacaacgctgccgtgatgagcagagttgtgggtgagaaa
ggccttgtggtctccgtggaatattcgaggaaaatctgcgagatcgcgaaaaggaacgtg
gaacgccttggaatagagaacgttatttttgtctgtggcgatggatactacggtgttccg
gagttttccccgtacgatgttatcttcgtaacagtcggtgtggatgaggtgccggagacg
tggttcactcaactcaaagaaggtgggagggtgatagtacctatcaatttgaaactttca
agaagacagcccgctttcctgttcaaaaaaaaggatccgtatcttgtgggaaactacaaa
ctggaaaccaggttcataacggcagggggcaatctcggaaatcttctcgagaggaacaga
aagcttttgagagaatttccattcaacagagagatcttactcgtacgttctcatatcttc
gtggagctggtggatctcctcaccaggagactcacagagattgatggaacgttctactac
gctgggccaaacggcgtggtagagtttctcgatgacaggatgagaatctacggggacgct
ccagagatagagaaccttttaactcagtgggaaagctgcggctacaggagcttcgagtat
ctcatgcttcatgtgggttacaacgctttttcacatatatcctgttctatttga

DBGET integrated database retrieval system