KEGG   Thermotoga petrophila: Tpet_0241Help
Entry
Tpet_0241         CDS       T00525                                 

Definition
(GenBank) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpt  Thermotoga petrophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpet_0241
   01230 Biosynthesis of amino acids
    Tpet_0241
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpet_0241
   00051 Fructose and mannose metabolism
    Tpet_0241
   00562 Inositol phosphate metabolism
    Tpet_0241
Enzymes [BR:tpt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tpet_0241
Exosome [BR:tpt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tpet_0241
  Exosomal proteins of bladder cancer cells
   Tpet_0241
  Exosomal proteins of melanoma cells
   Tpet_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(231975..232706)
Genome map
AA seq 243 aa AA seqDB search
MHKTIAEAKKFVSLLVNELHDVREFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQ
GAFTGEISPLMLKEIGVEYVIIGHSERRHIFKEDDELINRKVKAVLEKGMTPILCVGETL
EEREKGLTFCVVEKQVREGFYGLSKEEARKVVIAYEPVWAIGTGRVATPQQAQEAHAFIR
KLLSEMYDEETAEAVRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRG
VIS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacgatcgcggaagcgaagaagtttgtgtcgctgctcgtgaacgagctccac
gatgtgagagagtttgaaatagtggtctgtcctccgttcacagctctatctgaagtgggg
gaaatactctctggtagaaacatcaaattgggagctcagaacgttttctacgaagatcag
ggagctttcactggagagatttctcctctcatgttgaaagagatcggcgttgagtacgtt
atcatcgggcattccgagagaaggcacatcttcaaagaagacgacgaactcataaacaga
aaagtgaaagcggtgcttgaaaaaggtatgactcctattctctgcgttggggaaacactc
gaggaaagagagaaaggactcactttctgtgttgtggaaaaacaggtgagagaaggtttc
tatggtctcagcaaagaagaagcacggaaagtggtaatagcttacgagccggtttgggca
attggaacgggaagagtggcgacaccacagcaagctcaggaggcacacgcgttcataaga
aagctgctctcggagatgtacgatgaagaaacagctgaagcggtgaggattctctacggt
ggaagcataaaaccggacaatttcctcggtctcatcgttcagaaggatatagatggtggt
ctcgttggaggagcgagtctcaaagagtctttcatagagcttgcacgaataatgagaggt
gtgatttcctga

DBGET integrated database retrieval system