KEGG   Thermotoga petrophila: Tpet_0241Help
Entry
Tpet_0241         CDS       T00525                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00010  Glycolysis / Gluconeogenesis
tpt00051  Fructose and mannose metabolism
tpt00562  Inositol phosphate metabolism
tpt01100  Metabolic pathways
tpt01110  Biosynthesis of secondary metabolites
tpt01120  Microbial metabolism in diverse environments
tpt01130  Biosynthesis of antibiotics
tpt01200  Carbon metabolism
tpt01230  Biosynthesis of amino acids
Module
tpt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tpt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpet_0241
   00051 Fructose and mannose metabolism
    Tpet_0241
   00562 Inositol phosphate metabolism
    Tpet_0241
Enzymes [BR:tpt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tpet_0241
Exosome [BR:tpt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tpet_0241
  Exosomal proteins of bladder cancer cells
   Tpet_0241
  Exosomal proteins of melanoma cells
   Tpet_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ46270
JGI: Tpet0241
UniProt: A5IJ97
Position
complement(231975..232706)
Genome map
AA seq 243 aa AA seqDB search
MHKTIAEAKKFVSLLVNELHDVREFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQ
GAFTGEISPLMLKEIGVEYVIIGHSERRHIFKEDDELINRKVKAVLEKGMTPILCVGETL
EEREKGLTFCVVEKQVREGFYGLSKEEARKVVIAYEPVWAIGTGRVATPQQAQEAHAFIR
KLLSEMYDEETAEAVRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRG
VIS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacgatcgcggaagcgaagaagtttgtgtcgctgctcgtgaacgagctccac
gatgtgagagagtttgaaatagtggtctgtcctccgttcacagctctatctgaagtgggg
gaaatactctctggtagaaacatcaaattgggagctcagaacgttttctacgaagatcag
ggagctttcactggagagatttctcctctcatgttgaaagagatcggcgttgagtacgtt
atcatcgggcattccgagagaaggcacatcttcaaagaagacgacgaactcataaacaga
aaagtgaaagcggtgcttgaaaaaggtatgactcctattctctgcgttggggaaacactc
gaggaaagagagaaaggactcactttctgtgttgtggaaaaacaggtgagagaaggtttc
tatggtctcagcaaagaagaagcacggaaagtggtaatagcttacgagccggtttgggca
attggaacgggaagagtggcgacaccacagcaagctcaggaggcacacgcgttcataaga
aagctgctctcggagatgtacgatgaagaaacagctgaagcggtgaggattctctacggt
ggaagcataaaaccggacaatttcctcggtctcatcgttcagaaggatatagatggtggt
ctcgttggaggagcgagtctcaaagagtctttcatagagcttgcacgaataatgagaggt
gtgatttcctga

DBGET integrated database retrieval system