KEGG   Thermotoga petrophila: Tpet_0374Help
Entry
Tpet_0374         CDS       T00525                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpt  Thermotoga petrophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpet_0374
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpet_0374
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tpet_0374
Enzymes [BR:tpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tpet_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
363280..364326
Genome map
AA seq 348 aa AA seqDB search
MKLGILEKYREFLPVTDKTPMLSLNEGNTPLIPLVNMSRELGINIYVKYEGANPTGSFKD
RGMVVAVAKALEEGSKAIMCASTGNTSASAAAYAARAGIKAIVLIPEGKIALGKLAQAMI
YGAVVLQVRGNFDKCLELVKEITSKYPITLVNSINPYRLEGQKTAAFEIVDELGDAPDYH
FIPVGNAGNISAYWMGYKEYYQHGFSTKLPKMMGFQAEGAAPIVRGHPIENPETVATAIR
IGNPANWEKAVRARDESGGDIDMVSDEEILRAQRLLAQKEGIFCEPASAASIAGLLKKHR
QGIFRGGEIVVCTLTGNGLKDPNIVISQLEPPRIIEGRVEEILEVLDI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgggaatactcgaaaagtacagagaatttcttcccgtaacagacaaaaccccc
atgctctctttgaatgaagggaacactcctctcatacccctcgtgaacatgagcagggaa
ctcggaataaacatctacgtaaaatacgaaggggccaatccgacggggtccttcaaagac
agaggaatggtcgttgccgtcgcaaaggcactggaagaaggctcgaaagccatcatgtgc
gcttcaacggggaacacctccgcatccgctgccgcgtacgccgcaagggcaggaataaag
gcgatcgttctgataccagaagggaagatcgcactcggaaagctggctcaggcgatgata
tacggcgccgtggtgcttcaggtgagagggaatttcgacaagtgtctggaactggtcaag
gagatcacatccaaatatcccatcacactcgtgaacagtatcaatccctacagactcgaa
ggtcagaaaacggccgcttttgagatagtcgacgagctcggagatgcaccggactaccac
ttcatccccgtgggaaacgcgggcaacatctccgcttactggatgggatacaaggagtat
tatcagcatgggttctccaccaaactgccgaagatgatgggattccaggcggaaggggcc
gcccccatagttcgcggtcatcccatagaaaacccggagacggtcgccactgcaataagg
atcggtaaccccgcgaactgggaaaaagcggtccgggcacgcgatgaatcgggtggagac
atcgacatggtgagcgacgaagaaatactgcgcgcacagagactcttggctcagaaagaa
gggatcttctgtgagcccgcatccgctgcatcgatagcggggcttttgaagaagcacaga
cagggaatcttcaggggtggagagatcgttgtgtgtaccctcacagggaacggtttgaaa
gatccgaacatcgtcatctcacagcttgaacccccaaggatcatagaaggaagagtagaa
gagattctggaggtactcgacatatga

DBGET integrated database retrieval system