KEGG   Thermotoga petrophila: Tpet_0382Help
Entry
Tpet_0382         CDS       T00525                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpt  Thermotoga petrophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpet_0382
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpet_0382
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpet_0382
Enzymes [BR:tpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpet_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
369610..370878
Genome map
AA seq 422 aa AA seqDB search
MRIVVNLKPEEIPKHWYNVLADLPFKLDPPLDPETKQPISPEKLSVIFPMSLIEQEVSEE
RFIEIPEPVLKEYAVYRPTPLIRATFLEEYLQTPARIYYKYEGVSPTGSHKPNTAIAQAY
YNKIEGVKRLVTETGAGQWGSALSYAGAKFGLEVKVFMVKISYQQKPMRKYMMNLFGGKV
TPSPSEETNFGKKILSEDPDNPGSLGIAISEALEVAVSDPNTKYSLGSVLNHVLLHQTVI
GLEIKKQLELIGEKPDILLGCHGGGSNFGGTILPFVPDKLSGRDIRFVACEPAACPSLTK
GNYDYDFGDTAGLTPLLKMYTLGKDFIPPKIHAGGLRYHGSAPIIARLVKEGLVEAQAFD
QDETFEAAKIFAKLEGIIPAPESAHAIAGAIREAKKAKEEGKERVIVFTLSGHGLLDLTA
YV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgttgtgaatttgaaacctgaggaaatcccaaagcactggtacaacgtactc
gcagatcttccgttcaaactcgatccgccgctggaccccgaaacgaaacaacccatttca
cccgagaagctctctgttatcttccccatgagtttgatcgaacaggaggtctcagaagag
cgtttcatcgaaatacccgagcccgttctgaaagaatacgccgtttacagacccactccc
ctcatcagagccactttcttagaagagtacctccagactccggcgaggatctactacaag
tacgaaggagtgagccccactggaagccacaagccgaacacagccatcgcccaggcctac
tacaacaagatagaaggggtcaaaaggctcgtcacagaaacgggggcgggacaatggggt
agcgctctctcatatgccggcgccaagttcggattggaagtaaaagtgttcatggtgaag
atcagctaccagcaaaaaccgatgagaaaatacatgatgaacctcttcggaggaaaggta
actccaagccccagtgaagaaacgaacttcggaaagaagatcctgagtgaagatccagac
aatccaggtagtcttggcatcgccatcagtgaagcactggaagtggccgtgtctgatccg
aacacgaagtactccctcggaagcgtattgaaccatgttctgctccaccagacggttata
ggcctcgaaatcaagaaacagctcgaactcataggtgaaaaaccagacatcttactggga
tgtcacggaggaggatcgaattttggaggaacgatacttcccttcgttccagacaaactt
tccggaagggatatcaggttcgtcgcctgcgagcccgccgcgtgtccatccttgacgaaa
gggaattacgattacgatttcggagacaccgcgggactcacacctctgctgaaaatgtac
acccttggaaaggacttcattcctccgaagatacacgcgggaggtctcagataccacggc
tccgctccgataatcgcaagactcgtgaaagaaggacttgtggaggcacaggctttcgat
caggacgagacgtttgaggcagcgaagatcttcgcaaagctcgaaggaataattcccgcc
ccggaatccgctcacgccatcgcaggagccataagggaagcaaagaaagcgaaagaagaa
ggaaaagaacgtgtgatagtattcactctgagcggccacggtctgctcgatctcacagcg
tacgtgtga

DBGET integrated database retrieval system