KEGG   Thermotoga petrophila: Tpet_0610Help
Entry
Tpet_0610         CDS       T00525                                 

Definition
L-fucose isomerase N-terminal_2 domain-containing protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
tpt  Thermotoga petrophila
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tpet_0610
Enzymes [BR:tpt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Tpet_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(608046..609467)
Genome map
AA seq 473 aa AA seqDB search
MKQKYRVGLISFSDGREYVHKELEGIVKKFEDEIAKTLEETGEVEVIRAKEIVWKPSIAK
KEAKRLAEEGAEVTIFNYAVWAFPHFTVLASKFAPGPFLLFSNINPQYPGMVAMLSAAGA
LEQDGTKHYRMWGSIKDEKVLRKVMAFIRAGSTYKKLRGQRYGVFGGRSMGMYTAVPNVD
LWNKIFGVDVEHIDQFEIVRRSQLIPDERARKGRLWIEEKAKAFHYDGKYLTPEKLELQI
KSYHAVREIVEEMELDFVGIKGQLELTEHFVTMDVTEAFLNDPYDWEGEHEPIVCATEAD
SDGALTMQIFKLIAKTPVLFADVRHYVEEYDVLDLCNSGNHATYFAARSFDPDENMKKVE
FYPQTFYFPAGGAAVKHIAAPGKVTLGRLTREDGRYRFTVVPGEFVDFGEEKNYEIADSI
QNNWPHAFLKMETPIDEFLTKYSSNHIHGVYGDYVEEIKTFCEIAGIDFVLMK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaatacagggtgggactcatcagtttttccgatggaagagagtacgtgcac
aaggaacttgagggaattgtgaaaaagttcgaagatgagatagcgaaaactctggaagaa
acaggagaagtggaggtaatcagggcaaaagaaatcgtgtggaagccctcaatagcgaaa
aaagaggcaaaaagacttgcagaagagggagcggaagttaccatcttcaactacgcagtt
tgggcgtttcctcatttcacagtccttgcgagtaaatttgcaccgggaccgtttttgctc
ttttccaacataaacccgcagtatcctggtatggttgcgatgctttctgcggcgggggct
ctggaacaggacggaacgaagcactacaggatgtggggcagcataaaagacgagaaagtt
ctcaggaaagtgatggcattcatcagagcgggaagcacatacaaaaaactcaggggtcag
agatacggtgtgttcggtggaagatcgatgggtatgtacaccgccgttcctaacgtggat
ctgtggaacaagattttcggtgtcgatgtggagcatatagaccagttcgaaatcgttcga
agaagccagctgataccggacgagcgcgcaaggaaaggaaggctctggattgaagagaaa
gcaaaagcgtttcactacgatgggaagtacctcacacccgaaaagcttgaactccagata
aagagctaccacgcggtgagagagatcgtggaggagatggagctggactttgtgggaata
aaaggccagcttgaactcacagaacacttcgtgacgatggatgtgacagaggcgttcctg
aatgatccttacgactgggaaggagaacacgaaccgatcgtgtgtgcaacagaggcagat
tccgatggagcgctcacgatgcagatattcaagttgatcgcaaagacacccgtgctcttt
gcggacgtgagacactacgtggaggagtacgatgtactggatctgtgcaactcaggaaac
cacgcaacgtactttgcagccagatcgttcgatcccgacgagaacatgaagaaagtggag
ttctatccacagacgttctacttccccgcaggtggtgcagcggtaaaacacatagcagca
cccggaaaagtgacacttggaagactcacgagggaagatggaaggtacagattcacagtc
gttcctggagagttcgtggactttggggaggagaaaaactacgagatagcagacagcata
cagaacaactggccgcacgcgtttttgaagatggagacacctatagacgaattcctgacc
aaatattcctccaaccacatccacggcgtctacggagactacgtggaggagatcaaaacc
ttctgtgaaatagccggtatcgattttgtgcttatgaaatga

DBGET integrated database retrieval system