KEGG   Thermotoga petrophila: Tpet_0610Help
Entry
Tpet_0610         CDS       T00525                                 

Definition
L-fucose isomerase N-terminal_2 domain-containing protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
tpt  Thermotoga petrophila
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tpt00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(608046..609467)
Genome map
AA seq 473 aa AA seqDB search
MKQKYRVGLISFSDGREYVHKELEGIVKKFEDEIAKTLEETGEVEVIRAKEIVWKPSIAK
KEAKRLAEEGAEVTIFNYAVWAFPHFTVLASKFAPGPFLLFSNINPQYPGMVAMLSAAGA
LEQDGTKHYRMWGSIKDEKVLRKVMAFIRAGSTYKKLRGQRYGVFGGRSMGMYTAVPNVD
LWNKIFGVDVEHIDQFEIVRRSQLIPDERARKGRLWIEEKAKAFHYDGKYLTPEKLELQI
KSYHAVREIVEEMELDFVGIKGQLELTEHFVTMDVTEAFLNDPYDWEGEHEPIVCATEAD
SDGALTMQIFKLIAKTPVLFADVRHYVEEYDVLDLCNSGNHATYFAARSFDPDENMKKVE
FYPQTFYFPAGGAAVKHIAAPGKVTLGRLTREDGRYRFTVVPGEFVDFGEEKNYEIADSI
QNNWPHAFLKMETPIDEFLTKYSSNHIHGVYGDYVEEIKTFCEIAGIDFVLMK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaatacagggtgggactcatcagtttttccgatggaagagagtacgtgcac
aaggaacttgagggaattgtgaaaaagttcgaagatgagatagcgaaaactctggaagaa
acaggagaagtggaggtaatcagggcaaaagaaatcgtgtggaagccctcaatagcgaaa
aaagaggcaaaaagacttgcagaagagggagcggaagttaccatcttcaactacgcagtt
tgggcgtttcctcatttcacagtccttgcgagtaaatttgcaccgggaccgtttttgctc
ttttccaacataaacccgcagtatcctggtatggttgcgatgctttctgcggcgggggct
ctggaacaggacggaacgaagcactacaggatgtggggcagcataaaagacgagaaagtt
ctcaggaaagtgatggcattcatcagagcgggaagcacatacaaaaaactcaggggtcag
agatacggtgtgttcggtggaagatcgatgggtatgtacaccgccgttcctaacgtggat
ctgtggaacaagattttcggtgtcgatgtggagcatatagaccagttcgaaatcgttcga
agaagccagctgataccggacgagcgcgcaaggaaaggaaggctctggattgaagagaaa
gcaaaagcgtttcactacgatgggaagtacctcacacccgaaaagcttgaactccagata
aagagctaccacgcggtgagagagatcgtggaggagatggagctggactttgtgggaata
aaaggccagcttgaactcacagaacacttcgtgacgatggatgtgacagaggcgttcctg
aatgatccttacgactgggaaggagaacacgaaccgatcgtgtgtgcaacagaggcagat
tccgatggagcgctcacgatgcagatattcaagttgatcgcaaagacacccgtgctcttt
gcggacgtgagacactacgtggaggagtacgatgtactggatctgtgcaactcaggaaac
cacgcaacgtactttgcagccagatcgttcgatcccgacgagaacatgaagaaagtggag
ttctatccacagacgttctacttccccgcaggtggtgcagcggtaaaacacatagcagca
cccggaaaagtgacacttggaagactcacgagggaagatggaaggtacagattcacagtc
gttcctggagagttcgtggactttggggaggagaaaaactacgagatagcagacagcata
cagaacaactggccgcacgcgtttttgaagatggagacacctatagacgaattcctgacc
aaatattcctccaaccacatccacggcgtctacggagactacgtggaggagatcaaaacc
ttctgtgaaatagccggtatcgattttgtgcttatgaaatga

DBGET integrated database retrieval system