KEGG   Thermotoga petrophila: Tpet_0623Help
Entry
Tpet_0623         CDS       T00525                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpt  Thermotoga petrophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpet_0623
   01230 Biosynthesis of amino acids
    Tpet_0623
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpet_0623
   00030 Pentose phosphate pathway
    Tpet_0623
   00051 Fructose and mannose metabolism
    Tpet_0623
   00052 Galactose metabolism
    Tpet_0623
  Energy metabolism
   00680 Methane metabolism
    Tpet_0623
Enzymes [BR:tpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tpet_0623
Protein phosphatases and associated proteins [BR:tpt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tpet_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
621989..623248
Genome map
AA seq 419 aa AA seqDB search
MAERLGILVGGGPAPGINSVISSVTIEAINNGLEVIGIYDGFKHLVEGKTNMVKKLSIED
VSRIHIEGGSILRTSRVNPAKSEETLEKTVQTLKKLGIKYLVTIGGDDTAFSASKVCERS
KGEIKVVHVPKTIDNDLPLPENMPTFGFETARHVATELVYNLMQDSRTTNRWYFVAMMGR
EAGHLALGVGKAASATITIIPEEFKEGVTLEEVCDVLDGAILKRKLMGRDDGVAIIGEGI
AEKMDPEELANTPGVIVEKDPHGHLRLAEIPLATILKRAIERRYAERGERIHIVDVTIGY
ELRSARPIPFDIVYTRTLGYGAVRFLLGDYSDLPGGMVCVVGGRIKILPFDAFMDPKTGR
TKVRVVDVRSEDYRVARKYMIRLEKKDLEDPETLEKLAKLAKMEPEEFKKKYWHTTELP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagattggggatactcgttggtggagggccggcacctggaatcaacagtgtg
ataagttctgttaccatcgaagctataaacaacggactcgaagtgatcggaatatacgat
ggattcaaacacctcgtagagggaaaaacgaatatggtgaaaaaactttccatcgaagat
gtctccagaatccacatcgaaggtggatccattctcagaacctcgagggtgaatcctgcc
aaatccgaagaaaccctcgagaagacagttcagactctcaaaaagctcgggataaagtat
cttgttactatcggcggggacgacaccgcgttctccgcgagcaaagtgtgtgaaagatcg
aagggcgaaataaaggtggtccacgttccaaagactatagacaacgatctccctcttccg
gagaacatgcccacgttcggtttcgaaacagctcgtcacgtagccacagagctcgtctac
aatctcatgcaagactcaagaacaacgaacagatggtactttgtggccatgatgggaagg
gaagccgggcacctcgcactcggcgttggaaaagcagcgagtgcaacgatcacgatcatt
cctgaagagttcaaagagggagtgacgctcgaagaagtgtgcgacgttctcgatggggcg
attctcaagagaaaactcatgggaagagacgatggagtagcaataataggtgaaggtatc
gcagaaaagatggatcctgaggaacttgccaacactcccggtgtgatagtcgaaaaagac
ccacacggacacctgagacttgcagaaatcccgctcgccaccattctgaaacgggcgatc
gagaggagatacgctgaaagaggtgaaagaatccacatcgtcgatgtcacaataggatac
gaactcagaagcgcacgtcccatacccttcgacatagtatacaccaggacactcggttac
ggtgctgtgagatttctccttggagactattccgatctccctggcgggatggtgtgcgtg
gttggtggcagaatcaagattcttcccttcgacgctttcatggatccaaagaccggaagg
acaaaggtgagagtggtggatgttcgatcggaagattacagagtagcaagaaaatacatg
ataaggctggaaaagaaagatctcgaagatcccgaaactctcgaaaaactagcaaagctc
gcaaagatggaacctgaagaattcaaaaagaaatactggcacacgacagagcttccataa

DBGET integrated database retrieval system