KEGG   Thermotoga petrophila: Tpet_0623Help
Entry
Tpet_0623         CDS       T00525                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00010  Glycolysis / Gluconeogenesis
tpt00030  Pentose phosphate pathway
tpt00051  Fructose and mannose metabolism
tpt00052  Galactose metabolism
tpt00680  Methane metabolism
tpt01100  Metabolic pathways
tpt01110  Biosynthesis of secondary metabolites
tpt01120  Microbial metabolism in diverse environments
tpt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpet_0623
   00030 Pentose phosphate pathway
    Tpet_0623
   00051 Fructose and mannose metabolism
    Tpet_0623
   00052 Galactose metabolism
    Tpet_0623
  Energy metabolism
   00680 Methane metabolism
    Tpet_0623
Enzymes [BR:tpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tpet_0623
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tpet_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NRDD NAD_kinase SpoOE-like HGTP_anticodon
Motif
Other DBs
NCBI-ProteinID: ABQ46643
JGI: Tpet0623
UniProt: A5IKC0
Position
621989..623248
Genome map
AA seq 419 aa AA seqDB search
MAERLGILVGGGPAPGINSVISSVTIEAINNGLEVIGIYDGFKHLVEGKTNMVKKLSIED
VSRIHIEGGSILRTSRVNPAKSEETLEKTVQTLKKLGIKYLVTIGGDDTAFSASKVCERS
KGEIKVVHVPKTIDNDLPLPENMPTFGFETARHVATELVYNLMQDSRTTNRWYFVAMMGR
EAGHLALGVGKAASATITIIPEEFKEGVTLEEVCDVLDGAILKRKLMGRDDGVAIIGEGI
AEKMDPEELANTPGVIVEKDPHGHLRLAEIPLATILKRAIERRYAERGERIHIVDVTIGY
ELRSARPIPFDIVYTRTLGYGAVRFLLGDYSDLPGGMVCVVGGRIKILPFDAFMDPKTGR
TKVRVVDVRSEDYRVARKYMIRLEKKDLEDPETLEKLAKLAKMEPEEFKKKYWHTTELP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagattggggatactcgttggtggagggccggcacctggaatcaacagtgtg
ataagttctgttaccatcgaagctataaacaacggactcgaagtgatcggaatatacgat
ggattcaaacacctcgtagagggaaaaacgaatatggtgaaaaaactttccatcgaagat
gtctccagaatccacatcgaaggtggatccattctcagaacctcgagggtgaatcctgcc
aaatccgaagaaaccctcgagaagacagttcagactctcaaaaagctcgggataaagtat
cttgttactatcggcggggacgacaccgcgttctccgcgagcaaagtgtgtgaaagatcg
aagggcgaaataaaggtggtccacgttccaaagactatagacaacgatctccctcttccg
gagaacatgcccacgttcggtttcgaaacagctcgtcacgtagccacagagctcgtctac
aatctcatgcaagactcaagaacaacgaacagatggtactttgtggccatgatgggaagg
gaagccgggcacctcgcactcggcgttggaaaagcagcgagtgcaacgatcacgatcatt
cctgaagagttcaaagagggagtgacgctcgaagaagtgtgcgacgttctcgatggggcg
attctcaagagaaaactcatgggaagagacgatggagtagcaataataggtgaaggtatc
gcagaaaagatggatcctgaggaacttgccaacactcccggtgtgatagtcgaaaaagac
ccacacggacacctgagacttgcagaaatcccgctcgccaccattctgaaacgggcgatc
gagaggagatacgctgaaagaggtgaaagaatccacatcgtcgatgtcacaataggatac
gaactcagaagcgcacgtcccatacccttcgacatagtatacaccaggacactcggttac
ggtgctgtgagatttctccttggagactattccgatctccctggcgggatggtgtgcgtg
gttggtggcagaatcaagattcttcccttcgacgctttcatggatccaaagaccggaagg
acaaaggtgagagtggtggatgttcgatcggaagattacagagtagcaagaaaatacatg
ataaggctggaaaagaaagatctcgaagatcccgaaactctcgaaaaactagcaaagctc
gcaaagatggaacctgaagaattcaaaaagaaatactggcacacgacagagcttccataa

DBGET integrated database retrieval system