KEGG   Thermotoga petrophila: Tpet_0687Help
Entry
Tpet_0687         CDS       T00525                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tpt  Thermotoga petrophila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tpet_0687
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tpet_0687
Enzymes [BR:tpt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Tpet_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
690156..691628
Genome map
AA seq 490 aa AA seqDB search
MNISTIVSNLKDLILEVRAPYDLEITGVSNHSSKVKKGDLFICRRGEKFDSHEIIPEVME
KGAVAVVVEKEIDLDFPHIQVFDSRYFEAKVASLFFEDPWKDVLTFGVTGTNGKTTTTMM
IYHMLTSLGEKGSVLTTAVKRILGSSYYDDITTPDAITILSAMKENKEGGGKFFALEVSS
HALVQKRVEGVRFDVGIFTNISRDHLDFHGTFENYLKAKLHLFDLLKDDGIAILNESLAD
TFNRKSRKITFGTSKNADYRLGNIEVNWEGTRFVLETPDGLLRVFTKAIGDFNAYNAAAA
IAALHQLGYDPKDLASSLETFTGVEGRFEVVRGAKKIGLNVVVDFAHSPDALEKLLKNVR
KISQGRVIVVFGAGGNSDRGKRPMMSEVASKLADVVILTTDDPRGEDPEQIMEDLIKGID
KRKPYLVLFDRREAIETALTIANRGDSVVIAGRGHERYQIIDEEKKVPFQDREVVEEIIR
DKLKGRKYAQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcaactatcgtgtcgaatttaaaggatctcattttagaagttcgtgcaccc
tacgatctcgaaataacaggtgtgtccaaccactcttctaaggtaaaaaaaggagatctc
ttcatctgcagaagaggggaaaagttcgattcccacgagataatacccgaagtgatggaa
aaaggagcagtggctgttgtcgtcgaaaaagagatagatctggattttccccacattcag
gttttcgattctcgctattttgaggcaaaggtagccagcctcttcttcgaagacccctgg
aaagacgttttaacctttggagtcacaggaacaaacggcaaaaccacaacaaccatgatg
atctaccacatgctcacctcccttggagaaaaaggaagcgttctcaccaccgctgtgaag
agaattcttggaagctcctactacgacgacatcaccacaccggatgcgatcaccatcctt
tccgccatgaaagagaacaaggaaggtggaggaaagttcttcgccctcgaagtttcttct
cacgcactggttcaaaaaagagtcgagggagtcagattcgatgtgggtatattcaccaac
atatcacgcgatcacctcgactttcacggtacattcgagaactatctgaaagcaaagctt
catctcttcgatctgttgaaagatgacgggatagccattctgaacgaatcattggcagac
actttcaatcgaaaatcgagaaaaatcaccttcggaacatcgaaaaacgccgattacagg
ctgggaaatatagaggtgaactgggaggggacacggttcgttctggaaactcccgatggt
ttattgagggttttcacaaaggcgataggtgatttcaacgcttacaacgccgcggccgcc
attgctgctcttcaccagctcggatacgatccaaaagacctggcgagttccctcgaaacg
ttcacgggggtcgagggaagattcgaggtagtacgtggagcaaagaagattgggctcaac
gttgttgtcgacttcgcccattctccagacgcactggaaaagctcttgaaaaatgtcaga
aagatctctcagggaagagtgatagttgtcttcggggccgggggaaacagcgacagagga
aaacgtcccatgatgtctgaggtcgcttcaaaactcgctgatgttgtaatcctcacaacc
gatgacccacgaggagaagacccggaacagataatggaagacttgataaagggtattgat
aaacgcaaaccgtatctggtgctctttgacagaagggaagccattgaaacggccctaact
atcgctaacagaggagattctgttgtcatagcgggaagaggtcacgaaagataccagata
atcgatgaagaaaagaaggtaccgttccaggacagagaagttgtggaagagatcataaga
gacaagctgaaagggaggaaatatgcacaatga

DBGET integrated database retrieval system