KEGG   Thermotoga petrophila: Tpet_0699Help
Entry
Tpet_0699         CDS       T00525                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
tpt  Thermotoga petrophila
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tpt00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(702776..703714)
Genome map
AA seq 312 aa AA seqDB search
MRIDLSLKPTPVQFLKRLSEEYGFNIYVKRDDLTELVGSGNKIRKLEYLLWEALKKGATT
VFTCGGLQSNHARATAYVSRKHGLKPVLFLRKGEKVLNGNLLLDILLGAEIVEVSQEEYE
RIDEIFDVHKKMREKKGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLNLESFDAIVCAVG
SGGTIAGLSAGISFLEYHVPVVGVNVTTKNSDYFVGKVKRIISGMEEHGLKINETVFKVV
DDYRGPGYAIPSSEDVEILKEVASIESIILDPVYTAKAFRGMIEMFRNSGKNVLFIHTGG
IFGLFAQSGRLV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgatctttcccttaaacccacacctgttcagtttctcaaaagactctcggaa
gaatacgggttcaacatctacgttaaaagagacgatctcacagagcttgtgggatcgggc
aacaaaatcagaaagctggagtatcttctctgggaagctcttaaaaaaggagcaacaact
gtcttcacctgtggaggtcttcagtcgaaccatgccagagcaacggcatacgtttcgaga
aaacacggtttgaaacctgttctcttcctcagaaaaggagagaaggttctgaacggaaat
cttctcctcgacattctcctcggtgctgaaatagtggaagtttcccaggaagagtacgaa
cgcatcgatgagatcttcgatgttcacaaaaagatgagagagaagaaaggtgaaaaggtg
tacgtgatacccgaagggggatcgaactcccttggggcctttggctacttcaatgcggtg
ctggagatgaaagatcaattgaacctcgaatctttcgatgctatcgtgtgtgctgttgga
agtggtggaaccatagcgggtttgtcagctggaatttcctttctggaatatcacgtacct
gtggtgggtgtgaacgtcaccacgaaaaactcggattattttgtggggaaggtgaaaaga
ataattagtggtatggaagagcatggtctgaagatcaacgaaactgttttcaaagtggtg
gacgattacagagggccgggatatgcgattccgtccagtgaggatgtggagatcttgaaa
gaagtagcttcgatagaaagtatcatcctcgatccggtctacacggcaaaagccttcaga
ggaatgatcgaaatgttcagaaattcaggaaagaacgttcttttcatccacacgggggga
atattcggtctgttcgcgcagagcgggaggttggtataa

DBGET integrated database retrieval system