KEGG   Thermotoga petrophila: Tpet_0760Help
Entry
Tpet_0760         CDS       T00525                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tpt  Thermotoga petrophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tpt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
772788..773354
Genome map
AA seq 188 aa AA seqDB search
MIAGISGRVLKKSGNVLLVETKSGVVFEIVCDVQTSEEVEEGGECFLHTFLSVSQDGITL
YGFSNERKKELFLSLTKVSRLGPKTALKIISNEDAETLVTMIASQDVEGLSKLPGISKKT
AERIVMELKDEFESAGIKDMRIYHESLEALISLGYPEKQAREAVKHVYREGMKTSELIKE
ALKFLSQR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgggaatctctggaagggttttgaaaaagagtggaaacgttctcctcgtagag
acaaaatctggagtcgtttttgaaatcgtctgcgatgttcaaaccagtgaggaagtggaa
gaaggcggggaatgttttctccacacgtttttgagcgtttcacaggatggcatcaccctc
tacgggttttcaaatgagagaaaaaaggaactcttcctttctctcacaaaggtttccagg
cttgggccaaaaacggccttgaagatcatctcgaacgaagatgcggaaacactggtgaca
atgatcgcctctcaggacgtggaaggcctttcaaaacttcccggcatcagtaagaaaaca
gcagaacggatcgtgatggaactgaaagatgaattcgaaagtgctggaataaaagacatg
aggatctatcatgaatccttagaggccctgatatcactgggatacccggagaaacaggca
agagaagcggtgaaacacgtgtacagagagggaatgaaaacatccgagttgataaaagaa
gctttaaagtttctgagtcaaagatag

DBGET integrated database retrieval system