KEGG   Thermotoga petrophila: Tpet_0787Help
Entry
Tpet_0787         CDS       T00525                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpt  Thermotoga petrophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpet_0787
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpet_0787
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpet_0787
Enzymes [BR:tpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpet_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
799500..800669
Genome map
AA seq 389 aa AA seqDB search
MKGYFGPYGGQYVPEILMPALEELEAAYEGIMKDGSFWREFNDLLRDYAGRPTPLYFARR
LSEKYNARIYLKREDLLHTGAHKINNAIGQVLLAKRMGKTRIIAETGAGQHGVATATAAA
LFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSRTLKDAINEALRDWITNLQTT
YYVIGSVVGPHPYPIIVRNFQKVIGEETKKQILEKEGRLPDYIVACVGGGSNAAGIFYPF
IDSGVKLIGVEAGGEGLETGKHAASLLKGKIGYLHGSKTFVLQDDWGQVQVTHSVSAGLD
YSGVGPEHAYWRETGKVLYDAVTDEEALDAFIELSRLEGIIPALESSHALAYLKKINIKG
KVVVVNLSGRGDKDLESVLNHPYVRERIG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttactttggtccttacggaggtcagtacgttcccgagattctcatgcctgcc
cttgaagaactcgaggcggcttacgagggaatcatgaaggatggatcgttctggagagag
ttcaacgaccttctaagggattacgctggacgccccactcctctttacttcgccagaagg
ttgagtgaaaagtacaacgccaggatttatttgaagcgtgaagatcttcttcacacaggt
gctcacaagataaacaacgccataggtcaggtgcttctcgcgaagaggatgggaaaaaca
agaataatagcggaaacaggagcggggcagcacggcgttgccaccgcgacggccgctgcg
ctctttggaatggagtgcgtcatatacatgggcgaagaagacacgatcagacagaaaccc
aacgttgagagaatgaaactcctcggcgcgaaagtggttcccgtgaagagcggaagcaga
acgctgaaagacgccataaacgaagcccttcgggattggatcacgaaccttcagaccacc
tactacgttatcggatccgtcgtgggacctcacccgtatccgatcatagtgagaaacttt
cagaaggtgattggtgaggaaacaaaaaagcagatccttgagaaggaagggagattgccg
gattacatcgttgcgtgtgttggaggaggaagcaacgctgccggtatcttctacccgttc
atagattccggtgtgaagctgatcggagtggaagccggtggagaaggcctcgaaaccgga
aagcacgcagcttctcttctcaaagggaaaattggatacctacacggaagtaagaccttc
gttcttcaggatgactggggccaggttcaggtgacacactcggtttcggcgggactggac
tattccggtgtggggcctgaacacgcttattggagggagactggaaaagttctgtacgat
gcggtgacggatgaagaagctctcgatgccttcatcgaactttcaaggctggaagggatc
attccagcactcgaaagctctcacgcactggcttacctgaagaagatcaatataaagggt
aaggtcgtcgttgtgaacctttcagggcgcggcgacaaggatttagaatcagttttgaac
catccgtacgtcagggagaggataggatga

DBGET integrated database retrieval system