KEGG   Thermotoga petrophila: Tpet_0906Help
Entry
Tpet_0906         CDS       T00525                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00010  Glycolysis / Gluconeogenesis
tpt00020  Citrate cycle (TCA cycle)
tpt00620  Pyruvate metabolism
tpt00633  Nitrotoluene degradation
tpt00640  Propanoate metabolism
tpt00650  Butanoate metabolism
tpt00680  Methane metabolism
tpt01100  Metabolic pathways
tpt01120  Microbial metabolism in diverse environments
tpt01130  Biosynthesis of antibiotics
tpt01200  Carbon metabolism
Module
tpt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpet_0906
   00020 Citrate cycle (TCA cycle)
    Tpet_0906
   00620 Pyruvate metabolism
    Tpet_0906
   00640 Propanoate metabolism
    Tpet_0906
   00650 Butanoate metabolism
    Tpet_0906
  Energy metabolism
   00680 Methane metabolism
    Tpet_0906
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpet_0906
Enzymes [BR:tpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpet_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: ABQ46924
JGI: Tpet0906
UniProt: A5IL51
Position
complement(927823..929001)
Genome map
AA seq 392 aa AA seqDB search
MERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIPVE
SEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPINI
HCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHGVE
PVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKVFP
EIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKIWM
FRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGLGG
RDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtcgtcgagagagtggccgtcaccggcgctgaggccgttgccaatgcgatg
agacagatagagcccgatgtcgttgcggcgtacccgatcactccacagacacctattgtg
gagtacttcgccaggttcgtcgcggacggcgttgtcaggacagaaatgattcccgtcgaa
agtgaacacagtgcgatgagcgctgtcgttggagccgctgccgcgggagcaagagcgatg
acagcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgctgcctcc
tacagacttcccattgtgatgcccgttgtgaacagagcgctcagtggtcctataaacatt
cactgtgaccacagcgacgcgatggcagaaagggattctggatggattcagctctttgcg
gaaactaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaacacgaa
gatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacggagtggaa
cccgttgagttctatcccgatgaactcgtgaagaagttcgttggagagctcaaacccatg
tatcctcttctggatactgaacaccctgtaacctggggtcctctcgatctttacgattac
tacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtgttcccg
gaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggtttgtcgaaccgtac
agaatggaagatgcagagcacgtgatggtagcactgggctccacaaacagcacgataaag
tacgtggttgatgaactgagagaagaaggctacaaagttggatctttgaaaatctggatg
ttcagaccgttcccgaaggagcagcttcaggaactcctcaacggaagaaagagtgtagtt
gtgctcgacagagctgtttccttcggagcggaagcacctctctacgaagcagtgaaatct
gcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctcggtgga
agggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacggaaacctc
atagcagatgaacagagatatcttggtctcagagagtga

DBGET integrated database retrieval system