KEGG   Thermotoga petrophila: Tpet_0908Help
Entry
Tpet_0908         CDS       T00525                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tpt  Thermotoga petrophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpet_0908
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpet_0908
   00020 Citrate cycle (TCA cycle)
    Tpet_0908
   00620 Pyruvate metabolism
    Tpet_0908
   00640 Propanoate metabolism
    Tpet_0908
   00650 Butanoate metabolism
    Tpet_0908
  Energy metabolism
   00680 Methane metabolism
    Tpet_0908
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpet_0908
Enzymes [BR:tpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpet_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(929316..929918)
Genome map
AA seq 200 aa AA seqDB search
MLSRRCNRMPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAP
MRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKK
TGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQE
VIDANKRALRRGYEEVKCSE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgaggaggtgcaatcggatgcccgttgcgaagaaatactttgaaatacgatgg
cacggtagagccgggcaaggtgcgaagagtgcttcccagatgctggcagaagccgctctg
gaagccgggaaatacgttcaggcttttccagaatacggtgcagaaagaacaggtgctccc
atgagggccttcaacaggattggtgatgagtacatcagagtgagatctgcagtggaaaac
ccggacgtcgttgtggtgatcgatgaaacactactttctcccgccattgtagaaggcctt
tcagaagatggtatcctccttgtgaacaccgttaaggatttcgaattcgtcagaaaaaag
acaggattcaacggaaagatatgcgtggtggatgctacagacatcgctctccaggagata
aagagaggaataccgaacacaccgatgcttggagcgctggtcagagtgacaggtattgtg
cctctcgaggcgatagagaagagaatcgagaagatgttcggaaagaaattccctcaggaa
gtgattgatgcgaacaagagagctttgagacgtggatatgaggaagtaaagtgctcagag
tga

DBGET integrated database retrieval system