KEGG   Thermotoga petrophila: Tpet_1125Help
Entry
Tpet_1125         CDS       T00525                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tpt  Thermotoga petrophila
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpet_1125
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tpet_1125
Enzymes [BR:tpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tpet_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1150453..1151643
Genome map
AA seq 396 aa AA seqDB search
MEITKRIEELGEEMVESLKKFISINSVNPAFGGPGEKEKADWLEELLRGFGFEVDRYDVK
DDKGMWRSNVVAKIPGKNREKTLWIVTHIDTVPPGDLSLWETDPFVPVVKDGKVYGRGAE
DNGGSMIASIYAGKVLIDLGIVPEYNFGLALVADEEAGSRYGIQYLIEKGLFRSEDMFLV
PDAGNEKGNFIEIAEKSILWFKVTVNGKQGHASRPRTTENALRKGAQLITEIDETLHRKY
PDRDELFDEPLSTFEPTRTEKTVDNVNTVPGRFVFYFDCRVLPRYDLDEILSTVESILDG
RGAELEVVVKQPAPEPTPPDSELVAKLSSALGSLRGLEAKVGGIGGGTCAAFFRKKGWPA
VVWSTIDGTAHQPNEYRRISHMVEDAKVFALLGIER
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagatcacaaaaagaatagaagaactcggagaagaaatggtggagtccctgaaaaaa
ttcatctccatcaattcggtgaatcccgcctttggaggcccaggagagaaagaaaaggcc
gactggctcgaagaactcctcaggggtttcggtttcgaagtcgatcgctacgacgtgaaa
gacgataaaggtatgtggcgatcgaacgttgtggcaaagattccagggaaaaacagagag
aaaacgctctggatcgtaactcacatcgacaccgtaccaccgggggatctttctttgtgg
gaaacggatcccttcgtgcctgttgtgaaagatggaaaggtgtacggcagaggtgccgag
gacaacgggggatccatgatagcctccatatacgctgggaaggtcctcatcgaccttggt
atcgttcccgaatataacttcggtcttgcgctcgtcgccgacgaggaggcgggaagcagg
tacgggatccagtatctaatagaaaaggggttgttcagatcagaagacatgttcctggtt
ccggatgcaggaaacgaaaaggggaacttcatagagatcgccgagaagagcattctatgg
ttcaaagtgacggtgaatggaaagcaagggcatgcttcaaggccgaggacaacggagaac
gcactcagaaaaggagcacagctcataacggagatagatgaaacgcttcacaggaaatac
cccgatagagacgaactcttcgatgaaccactcagcacgttcgagcccactcgcactgaa
aaaactgtggacaacgtgaacactgttcccggcagattcgtcttttacttcgactgtaga
gttctgcctcgctacgatctcgacgaaatactatccaccgtcgagtcgattctcgatgga
agaggcgctgagctggaggttgttgtaaaacagcctgcacccgagccaactccgcctgat
tcagaactcgtggcaaaactttccagtgctttgggaagtctaagaggcctggaagcgaag
gtgggaggaataggtgggggcacctgcgccgcgttcttcagaaagaaaggttggcccgct
gtcgtctggagcacgatagatgggactgctcatcaacccaacgaataccgaaggatctcg
cacatggtagaagacgcaaaggtgttcgcattgctcggaattgagaggtga

DBGET integrated database retrieval system