KEGG   Thermotoga petrophila: Tpet_1150Help
Entry
Tpet_1150         CDS       T00525                                 

Definition
dihydrofolate reductase-like protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tpt  Thermotoga petrophila
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tpet_1150
   00670 One carbon pool by folate
    Tpet_1150
Enzymes [BR:tpt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Tpet_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1174357..1174866)
Genome map
AA seq 169 aa AA seqDB search
MAKVIFVLAMDVSGKIASSVEGWNSFEDRKNFREITTEIGNVVMGRVTFEEIGRPLPERL
NVVLTRRRRSSNDPSLVFFNGSPGDVVKFLEGKGYEKVAVIGGKTVFTEFLREKLVDELF
VTVEPYVFGKGIPFFDEFEGYFPLKLLEMRRLNERGTLFLKYSVEKSHR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtgattttcgttcttgcgatggacgtctccggaaaaatagcttcctctgtt
gaaggctggaactcatttgaggacagaaaaaatttcagagagatcaccacagagatcgga
aacgttgtgatgggaagggtcacattcgaagaaataggaagacctcttccagagaggctg
aacgttgttttgacgagaagacgcaggtcttccaacgatccttcacttgtttttttcaac
ggttcacctggggatgtggtaaaattcctcgaaggaaaaggctacgaaaaggtggctgtc
ataggaggaaagaccgtgttcacggaatttctgagagaaaaactggtagatgagcttttc
gtcaccgtcgaaccgtacgtgttcgggaagggaatacctttcttcgatgaattcgaaggt
tactttcctttgaaacttctggagatgaggcgtttgaacgaaagaggcacactttttctc
aaatattctgtagaaaaatcgcaccgttag

DBGET integrated database retrieval system