KEGG   Thermotoga petrophila: Tpet_1364Help
Entry
Tpet_1364         CDS       T00525                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tpt  Thermotoga petrophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tpt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1353783..1355273)
Genome map
AA seq 496 aa AA seqDB search
MKYVLSLDQGTTSSRAIVFDEKGNVVSKVNKEFRQIYPKPGWVEHDPMEIWESQIEVAKK
AIEEAGIKPQDIAAIGITNQRETTIVWDKNTGKPVYNAIVWQCRRTAPICDDLKERGYSE
FIRERTGLVIDAYFSGTKIKWILDNVEGVREKAEKGEVLFGTVDTWLIWNLTGGKVHVTD
YSNASRTMIFNIHKLDWDDDILELLNIPRPMLPQVMPSSHVYGYTAKDIFGVEIPIAGNA
GDQQAALFGQACFQPGMLKNTYGTGCFLLMNTGEKAFESKSGLLTTIAWGINGKVYYALE
GSIFITGAAVQWLRDGLRIISNAAETEELATKVPDNGGVFFVPAFVGLGAPYWDMYARGL
IIGITRGTTREHIVRAVLESIAYQTKDVVEAMEKDSDIKVDTLRVDGGAVVNNFLMQFQA
DILGVPVERPVVNETTALGAAYLAGLAVGYWKDQEEIASLWQLDRRFEPSMNSEERERLY
SKWKEAVSRSLGWEKQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgttctctctcttgatcaaggtacaacgagctccagagcgatcgttttcgat
gaaaaaggaaacgtggtatcgaaagtcaacaaagaattcagacagatctatccaaaaccg
gggtgggtagagcatgatcccatggaaatttgggaatcacagatcgaagtagcaaagaaa
gctatcgaagaggcagggataaaaccacaagacatcgctgccataggtatcacaaatcag
agagaaaccaccatcgtctgggacaaaaacaccgggaaacctgtctacaacgccatagtc
tggcagtgcagaagaaccgctcccatctgtgacgatctcaaagaaagaggatactcagag
ttcattagagaaagaacaggtctcgtcattgatgcgtacttttctggaacgaagatcaag
tggattctcgacaacgtcgaaggagtgagagaaaaggcagaaaagggcgaagtactcttt
ggaacagttgacacctggctcatatggaatctcacgggtggaaaggttcacgtaaccgat
tactcaaacgcttccagaacaatgatcttcaatatacacaaactcgactgggacgatgac
atcttggaacttcttaacataccgaggccgatgcttccacaggtgatgccgtcaagtcac
gtgtatggttacacagcaaaagatatcttcggagtggaaatacctatagctggaaacgct
ggagatcaacaggcagcactgtttggacaagcctgcttccagcccggtatgttgaaaaac
acctatgggacaggatgtttcctcctcatgaacaccggagagaaagccttcgaatcgaaa
tccggtcttctcacaaccatcgcgtggggaataaacgggaaggtttactatgcccttgaa
ggcagcatatttatcactggcgccgctgtgcaatggctaagggatggtctgaggatcatc
tcaaacgccgcagaaaccgaagaactcgccacaaaagtgccagacaacggaggggtgttc
ttcgttcccgcgttcgtcggactcggtgctccctactgggacatgtacgcgcggggtctg
ataataggcataaccagaggtaccaccagagagcatatagtaagggccgttcttgaatcg
atagcctatcagacaaaggatgtggtggaagccatggagaaagatagcgacataaaagta
gatacacttcgagtcgacggtggagctgttgtgaacaacttcttgatgcaattccaggcc
gatatcctcggagttcccgttgaaaggcccgttgtgaacgaaacaacagcccttggagct
gcttaccttgcaggactcgcggttgggtactggaaagatcaagaagagatagcttctctc
tggcaactcgacagaagatttgaaccctctatgaattccgaggaaagagagaggctgtat
tcaaaatggaaagaggcagtgtcgagatcccttggatgggaaaaacagtga

DBGET integrated database retrieval system