KEGG   Thermotoga petrophila: Tpet_1432Help
Entry
Tpet_1432         CDS       T00525                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tpt  Thermotoga petrophila
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tpt00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1420299..1421708
Genome map
AA seq 469 aa AA seqDB search
MVRVRFAPSPTGFLHVGGARTALFNFLFARKEKGKFILRIEDTDLERSEREYEEKLMESL
RWLGLLWDEGPDVGGDHGPYRQSERVEIYREHAERLVKEGKAYYVYAYPEEIEEMREKLL
SEGKAPHYSQEMFEKFDTPERRREYEEKGLRPAVFFKMPRKDYVLNDVVKGEVVFKTGAI
GDFVIMRSNGLPTYNFACVVDDMLMEITHVIRGDDHLSNTLRQLALYEAFEKAPPVFAHV
STILGPDGKKLSKRHGATSVEAFRDMGYLPEALVNYLALLGWSHPEGKELLTLEELISSF
SLDRLSPNPAIFDPQKLKWMNGYYLRNMPIEKLAELAKPFFEKAGIKIIDEEYFKKVLEI
TKERVEVLSEFPEESRFFFEDPAPVEIPEEMKEVFSQLKEELQNVRWTMEEITPVFKKVL
KQHGVKPKEFYMTLRRVLTGREEGPELVNIIPLLGKEIFLRRIERSLGG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttggtaagggtgagattcgcaccgagccccactggctttctccacgttggaggagctcga
accgctctgttcaactttcttttcgcacggaaagaaaaaggaaagttcatcctcagaata
gaagacaccgatttggagagatctgagagggagtacgaagagaagctcatggaatctctc
aggtggcttggtcttctgtgggatgagggaccggacgtgggaggagaccacggtccatac
aggcagagcgagagagtggagatatacagagaacacgctgaaaggcttgtaaaggagggg
aaggcctattacgtttacgcttaccctgaagagatcgaagagatgagggagaaactcctc
tctgaaggaaaggcaccacactactcccaggagatgttcgaaaagtttgatactcccgag
agaagaagggaatacgaagaaaagggtttgaggccggctgtgtttttcaagatgcccaga
aaagactatgtgttgaacgatgtggtgaaaggtgaagttgtgttcaagacaggagcaatt
ggggattttgtgataatgagaagcaacggtcttcccacctacaatttcgcctgtgtggtg
gatgacatgctcatggaaataacacacgttatccgtggagacgaccatctctcaaataca
ctgagacagctcgctctctatgaagcgtttgaaaaggctccccccgtttttgcgcacgtt
tccaccatactgggacccgatggaaaaaaactgagcaagagacatggagccacttctgtg
gaagcgttcagagacatgggatatcttccggaggcgcttgtcaactatctggcacttctt
ggatggtctcacccagagggtaaagaactcctcactctcgaagaattgatttcttcgttt
tctctggacaggctcagcccgaaccctgcgattttcgacccacagaagttgaaatggatg
aacggttactatttgaggaacatgccgattgagaagctcgcagaactggcaaagccgttc
tttgagaaagccgggataaaaataatcgacgaggagtactttaaaaaggtattggagatc
acaaaagagagagtagaggtgctttcagaatttcctgaagagtcccgcttcttctttgaa
gatccagcacctgttgaaataccagaagaaatgaaagaagtgttttcacagctcaaagaa
gagctccagaacgttcggtggaccatggaagaaatcacacctgtcttcaagaaggtactg
aaacaacacggtgtaaagcccaaagaattctatatgacgttgagaagagttctgactggt
agagaagaaggtcctgaactcgtcaacattattcctcttcttggaaaggagatctttttg
agaagaatagaaagatctctggggggatga

DBGET integrated database retrieval system