KEGG   Thermotoga petrophila: Tpet_1559Help
Entry
Tpet_1559         CDS       T00525                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tpt  Thermotoga petrophila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tpt00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpt00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tpt00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1554653..1557907
Genome map
AA seq 1084 aa AA seqDB search
MSYEWENPQLVGEGTEKPHASFIPYLDPFSGEWEYPEEFISLNGNWGFLFAKNPFEVPED
FFSENFDDSNWDEIEVPSNWEMKGYGKPIYTNVVYPFEPNPPFVPKDDNPTGVYRRWIEI
PEDWFKREIFLHFEGVRSFFYLWVNGKKIGFSKDSCTPAEFRLTDVLRPGKNLITVEVLK
WSDGSYLEDQDMWWFAGIYRDVYLYSLPKFHIRDVFVRTDLDENYRDGKIFLDVEMRNLG
EEEEKDLEVTLITPDGDEKTLVKETVKPEDRVLSFAFDVKDPRKWSAETPHLYVLKLKLG
EDEKKVNFGFRKIEIKDGMLLFNGKPLYIKGVNRHEFDPDRGHAVTVERMIQDIKLMKQH
NINTVRTSHYPNQTKWYDLCDYFGLYVIDEANIESHGIGWDPEVTLANRPEWEKAHLDRI
QRMVERDKNHPCVIFWSLGNEAGDGVNFEKAALWIKERDNTRLIHYEGTTRRGESYYVDV
FSLMYPKIDVLLEYASRKREKPFIMCEYAHAMGNSVGNLKDYWDVIERYPYLHGGCIWDW
VDQGIRKKDENGKEFWAYGGDFGDEPNNKNFCCNGVVLPDRTPEPELYEVKKIYQNIKVR
QISIDTYEVENGYLFTDLEMFDGTWRIRKDGEVIEEGRFKLSAEPGERKIFKIPLPVMED
SEYFLEICFALSEDTLWAKKGHVVAWEQFLLKPPIFQKSIVQEKVDFSEDGRYLLVRTKD
AEFIFSKLTGLLEHIVYRGRNILTGSIVPNFWRVPTDNDIGNRMPERLSIWKKASSERKL
FKMFWKRRENSVSVQSVYQVPGNSWVYLTYTIFGNGDILVDLSLIPAEGVPEIPRIGLQF
TVPEEFGTVEWYGRGPHETYWDRKESGLFARHRKAVDEMIHRYVRPQETGNRSDVRWFAL
SDGETKLFVSGMPQIDFSVWPFSMEDLERAQHISELPERDFVTVNVDFRQMGLGGDDSWG
AMPHLEYRLLPKPYRFSFRMRISKEIPSWRVLAAIPETLHVEMSSEDVIREGDTLRVKFS
LLNDTPLSKEEQVVLFVDGNEYSVRRVVIPPFKKEELVFKVEGLKKGEHLIHTNLNTRKT
IYVR
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgaatgggaaaacccacagcttgtgggtgaaggaacggagaagccacacgct
tctttcataccctatctggacccgttcagcggggaatgggagtaccctgaggaattcatc
tctttgaacgggaactgggggtttctcttcgcgaaaaatcccttcgaggtgccggaggat
ttcttttcagagaacttcgacgactcgaactgggatgagatagaagttccaagcaactgg
gagatgaaaggatatgggaagcccatctacacgaacgtggtttatccatttgaaccgaac
cctccttttgttccaaaagacgacaatccgaccggggtgtacagaaggtggatcgagata
cctgaggattggttcaaaagggagatctttctgcattttgaaggtgttcgatccttcttc
tatctgtgggtgaacgggaagaagatcggtttcagcaaagacagctgcacacccgctgaa
ttcagactcaccgatgttctaaggccagggaagaatctgatcaccgttgaggttctgaag
tggagcgatggaagctatctcgaagatcaggacatgtggtggtttgcggggatatacagg
gacgtttatctgtactcgctgccgaaatttcacatcagggacgtgttcgtgagaacggat
ctggatgaaaattacagagacggaaagatctttctggacgtagagatgagaaatctcggt
gaggaagaagaaaaagaccttgaagtaacactcatcacaccggatggagacgaaaaaaca
ctcgtgaaagagacagtaaagccggaggacagagtcctttcctttgcctttgacgtgaaa
gatccgaggaagtggtccgcggagacaccacatctgtacgttttgaaactgaaactggga
gaagacgaaaagaaagtcaacttcggattcaggaagatagagataaaagacggaatgctt
cttttcaacgggaaacctctctacataaagggagtgaacagacacgagttcgatcctgac
aggggtcatgcggtgacggtggagaggatgattcaggacataaaactcatgaagcagcac
aacataaacacagttcgcacatcgcactatccgaaccagacgaagtggtacgatctgtgt
gactattttggactctacgtgatagacgaggcaaacatcgaatcccacggtataggctgg
gatcctgaagtgacacttgcgaacagaccggaatgggagaaggcacatctcgacagaatc
cagaggatggtcgagcgtgacaagaatcatccgtgtgttatcttctggtctcttggaaac
gaagcgggagacggagtgaatttcgaaaaagccgctctctggataaaggaaagagacaac
acgcggcttatccattacgagggaacaacaaggaggggagaatcgtactacgtggatgtt
ttctctctcatgtacccgaagatagacgttcttcttgagtacgcctccagaaagagggaa
aagcctttcatcatgtgtgagtatgcccacgcgatgggaaacagtgtgggaaatctgaag
gactactgggatgtgatagaaaggtatccgtatcttcacggagggtgcatctgggactgg
gtggaccagggaatcaggaagaaggatgaaaacggaaaggaattctgggcgtacggtgga
gatttcggcgatgaaccaaacaacaagaatttctgctgcaacggagtggtccttcccgac
agaacacccgagccagagctttacgaggtgaagaaaatctatcagaacatcaaagtgcgt
cagatctcaatagacacctacgaagtggagaacgggtatcttttcacagaccttgagatg
ttcgatggaacttggaggatcagaaaggacggtgaagtgatagaagaaggaaggttcaaa
ctctcagccgagccaggagaaaggaaaatttttaagataccacttccagtgatggaagac
tcggaatacttccttgagatctgttttgctctctctgaagataccctctgggcgaagaag
ggacacgttgtagcgtgggaacagttcctcctgaaacctcccatctttcaaaaaagcatt
gttcaggaaaaagtagatttctcagaagatggaagataccttctggtgaggacaaaagac
gcggagtttatcttctcgaaactcaccggccttctggagcacatcgtgtacaggggaaga
aatatcctgacaggatcgatcgttccaaatttctggagagttccaacggacaacgatatc
ggaaacagaatgccggaaagactctccatatggaaaaaggcatcgagcgaaagaaagctc
ttcaagatgttctggaagagaagggaaaacagcgtttccgttcagagtgtctatcaggta
cccggaaacagctgggtgtacctcacctacaccatctttggaaacggtgacatcctcgtg
gatctttccctgattcccgcagaaggtgtaccggagattccaaggatcggtcttcagttc
acggtccctgaagagttcggcaccgtggagtggtacggaaggggaccgcacgagacttac
tgggacagaaaagaaagtggccttttcgcaaggcacagaaaagctgtcgatgagatgata
cacaggtacgtcaggccccaggaaacggggaacagatcggacgtgagatggtttgcgctt
tccgacggtgaaacaaaactctttgtgtcaggcatgccgcagatagacttcagcgtctgg
cccttttccatggaggatctcgagagggctcagcacataagtgaactcccggagagggac
ttcgtcaccgtgaacgtggacttcagacagatgggccttggaggagacgacagctggggt
gcgatgcctcatctggagtacaggcttctaccaaagccgtatcgtttttctttcagaatg
aggattagcaaagagattccatcctggagggttcttgcggcgatccctgaaacgctccat
gttgagatgtcctcagaagacgtgatacgcgaaggagacaccctgagagtgaaattttcc
cttctgaacgacactccactgagcaaggaagaacaggtggttctctttgttgatggaaac
gaatactcggtgaggcgagtggtgattccacccttcaagaaggaagagctggtgttcaaa
gtagaaggattgaagaagggagaacatctgatacatactaatctgaacacgagaaaaact
atctacgtgaggtga

DBGET integrated database retrieval system