KEGG   Thermotoga petrophila: Tpet_1676Help
Entry
Tpet_1676         CDS       T00525                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tpt  Thermotoga petrophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tpt00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tpt00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpt00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1671301..1672701
Genome map
AA seq 466 aa AA seqDB search
MPTIVFVGAGSVRYTIKLVGDLAKTPELYGSRLVLMDIDEERLKATYVLVTKYLRELNAE
YTVEQTTSLEKALEEADFVINTALYRAPGHEDGYVHYEIMRGVGERHGYYRGIDSQELNM
VSDYYTLSNYNHLKMSLDIAKAVEKISPNAWILQTANPVFEITQLVKRLTKAKIVGFCHG
YAHVFHLAKVLGVEPEELDWQVAGVNHAIWMNRFRCRGEDLYPKLDEWIEKNASKWEPKN
PWDVDFSPAAIDMYRFYGMYPIGDTVRSGTWKYHYDLETKKRWYGKFGGIDNEVERPKFY
ESLRKQRKRLMELAKEVEKDPTIELTKVWPEVFTTGSESVEQHIPFINALVNNKKARLVL
NIENRGVIKGIPDDVVVEVPVVVDKEGIHPEKIEPDLTDRIKKFYLLPRILRMEWALEAF
ISGDRRVLEEILVRDPRTRSYEQAVAVIDDILNLPFNEEMKKHYGG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccattgtatttgtaggagcggggagcgtaaggtacacgatcaagctggtaggg
gacctggcgaagacaccggagctgtatgggtcaagactggtattgatggacatcgacgaa
gaaaggttgaaagcaacgtacgttctcgtcacaaagtacctcagagaactgaatgcagag
tacacagtggaacagacaacaagccttgagaaagcacttgaagaggcagactttgtcatc
aacacagccctctacagggcaccaggacacgaagatggatacgtacactacgagatcatg
aggggagtaggagagagacatggctactacagagggatagacagccaggagctgaacatg
gtctcggactactacacactcagcaactacaaccacctgaagatgagccttgatatagca
aaggcagtggagaagatatcaccgaatgcgtggatactgcagacggccaatcccgttttt
gagatcacgcagcttgtgaagagacttacgaaagcgaagatagtgggtttctgccacgga
tatgcgcacgtgttccaccttgcgaaggtactcggtgtggagccagaagaattagactgg
caagtagcaggggtgaaccatgcgatatggatgaacaggttcaggtgcagaggggaggat
ctctatccgaagctggacgaatggatagagaagaacgcgtcgaagtgggagccgaagaat
ccatgggatgtggacttttcacctgcagcgatagacatgtacaggttctacgggatgtac
ccgataggggacacggtgaggagtgggacatggaaataccactacgatcttgagacaaag
aagagatggtacgggaagtttggagggatagacaacgaagtggagaggccgaagttctac
gagagtttgagaaagcagaggaagagactgatggaacttgcgaaagaagtggaaaaagat
ccaacgatagagctgacgaaggtgtggcctgaggtgttcacaacaggcagtgagagtgta
gagcagcacataccgttcataaacgcgcttgtgaacaacaagaaagcgaggcttgtgttg
aacatagagaacagaggggtgataaaggggataccggacgatgtggtggtggaggtgccg
gtggtagttgataaagaagggatacatccggagaagatagagcctgatcttacagacagg
atcaagaagttctatcttcttccaaggatactcaggatggagtgggcacttgaggcgttc
atatctggtgacaggagggttctggaggagatcctcgtcagggatccaagaaccagatct
tacgaacaggctgttgctgtcatcgatgatatccttaacctccccttcaacgaggaaatg
aagaagcactacggcggttga

DBGET integrated database retrieval system