KEGG   Thermotoga petrophila: Tpet_1709Help
Entry
Tpet_1709         CDS       T00525                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tpt  Thermotoga petrophila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tpt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1708185..1709471
Genome map
AA seq 428 aa AA seqDB search
MILMNNPGDKEVLRLLKQRMESVSQVEEAVKEIIRRVKEEGDRALEEFLKRFEKHPVGIE
NLRVTKKEISEAQVEEEFVETIKMVIEDLKEFHRRQEERSFFFTTKGGSFLGEMVVPLES
VGIYVPGGKVPYFSTLLMCAVPAIVAGVERIVVTTPPDENGGISPYILKTCEILGLKEIY
RMGGAHAVAALTYGTETVKPVDKIVGPGGVFVTLAKKHVYGDVGIDSIAGPSEITIVTDG
SVDLDLVAADFLSQAEHDENAMSVVITTSREVFEKLPHVIERHLEALPEERRKTARISTE
NFGTIILTDSLKRAFEISNLIAPEHLEVLVEKPFESLGYIKNAGSVFLGKYTCESVGDYG
AGPNHVLPTFRSARFSSGLRVSDFTKKIFITYLSEEDFKRKGELYSKMARWEGFEAHARA
IDVRRGKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgattttgatgaacaaccccggagataaagaagtgctcagactgttgaaacagaggatg
gaatccgtatcgcaggtggaagaggccgtaaaagagatcatcaggagagtgaaagaagaa
ggagacagagccctcgaagaattcctcaaaaggtttgagaagcacccggtgggcatcgag
aaccttcgtgtcacaaagaaggaaatatcggaagcccaagtagaagaagaattcgttgaa
acgataaaaatggtgatagaagacctgaaagaattccatcgaagacaggaggaaagatct
ttctttttcacgacgaagggtggaagtttcctgggagagatggttgtccctctcgagagc
gtgggaatttacgttcctggaggaaaggttccgtacttctctacgctcctcatgtgtgcg
gttcctgctatcgtcgctggtgtggaaaggatcgtcgtcacaacaccaccagatgaaaac
ggaggcatctccccatacatcctgaaaacctgcgaaatcctcggtctgaaagagatctat
cggatgggaggagctcatgcggtggctgctctcacgtacggcacggaaacagtgaaaccc
gttgacaagatcgtgggaccaggtggagtcttcgtcacgctcgcgaagaaacacgtttac
ggagacgtcggaatcgactccatagcaggtcccagtgagatcacgatcgtgacggacggt
agcgttgatctggatctcgtagccgcggattttctctcccaggcggagcacgacgagaac
gcgatgagcgtggtgataaccacctcgagagaagtcttcgaaaaattgcctcatgtcata
gaaagacacctggaagctcttccagaagagagaagaaaaacggccaggatctcaacggaa
aacttcggtaccatcatcttgacagacagtctgaaaagggcctttgagatctccaacctc
atcgctcccgaacatctggaagtcctcgtggaaaagccgtttgaatcgctgggatatata
aagaacgcgggatctgttttccttggaaagtacacctgtgagtctgtgggagactacggt
gcgggaccgaaccacgtccttcccaccttcagatccgcgagattctcctccggactcaga
gtttccgatttcacgaagaagatattcatcacgtatctctccgaagaagatttcaaaaga
aagggcgagctttactcgaagatggcacgttgggaaggttttgaagcccacgctcgggca
atagacgtcaggaggggaaaactgtga

DBGET integrated database retrieval system