KEGG   Thermotoga petrophila: Tpet_1725Help
Entry
Tpet_1725         CDS       T00525                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tpt  Thermotoga petrophila
Brite
Enzymes [BR:tpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Tpet_1725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1720776..1721537
Genome map
AA seq 253 aa AA seqDB search
MNFPRCKTVEKSLPIFLKGENEGVLFIHGYTGSPHDFEYMAKEVNRVGFTVSVPRLPGHG
TCGEDFLMTTARDWLRRVFDAYYDLKAICDRVHVVGLSMGGVIALILASQMNPPKLVTLA
AATHVFDKRIVLTPLLKLFSKKMPRKSTEKYEDPGIEYLRKEYWSYNWPKQAAELYKLMR
LARKSVSKITSDTLVVAAKNDNMVPMKATEFIYNNIRSENKKLLVFEKSGHVLSNDVEKE
DVTKAVIEWLKGE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccacgatgtaaaactgtggagaagtcgctcccgatcttcctcaagggtgaa
aacgaaggtgttttattcatccacggttacacgggatcaccccacgatttcgagtacatg
gcaaaagaggtgaacagagtgggtttcaccgtttccgttccgagacttccaggacacgga
acctgtggtgaagattttctgatgacaaccgctcgagactggctgagacgcgtcttcgat
gcatattacgatttaaaagccatatgcgatagagtccatgtggttggactttccatgggt
ggtgtgatcgccctgatactcgcatctcagatgaatcctccaaaactggtcacacttgcc
gcggcaacacatgttttcgacaaaaggatagtcctcacgcctcttttgaagctcttttcg
aagaagatgccccgcaaaagcacagaaaagtacgaagatccgggcatcgaatacctgaga
aaagagtactggtcttacaactggcccaagcaggcagcggagctctacaaactcatgaga
ctggcaagaaagagtgtttcgaagatcacatcggacactctcgtcgttgcggcaaagaac
gacaacatggttcccatgaaggcaaccgagttcatatacaacaacatcagatcagaaaac
aagaagcttcttgtttttgaaaaatccggtcacgttctgagcaacgacgtggagaaggaa
gatgtcactaaggcggtcatagaatggctgaagggggaatga

DBGET integrated database retrieval system