KEGG   Treponema pallidum subsp. pallidum DAL-1: TPADAL_0108Help
Entry
TPADAL_0108       CDS       T01748                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpu  Treponema pallidum subsp. pallidum DAL-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPADAL_0108 (pfk)
   01230 Biosynthesis of amino acids
    TPADAL_0108 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPADAL_0108 (pfk)
   00030 Pentose phosphate pathway
    TPADAL_0108 (pfk)
   00051 Fructose and mannose metabolism
    TPADAL_0108 (pfk)
   00052 Galactose metabolism
    TPADAL_0108 (pfk)
  Energy metabolism
   00680 Methane metabolism
    TPADAL_0108 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TPADAL_0108 (pfk)
Enzymes [BR:tpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TPADAL_0108 (pfk)
Protein phosphatases and associated proteins [BR:tpu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TPADAL_0108 (pfk)
Messenger RNA biogenesis [BR:tpu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TPADAL_0108 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(122284..123669)
Genome map
AA seq 461 aa AA seqDB search
MAHLPKEYDFSIESLGESKIPSPIYLSHTLGDFIPNYVSDNEYISHELSARLGETVGPFT
HKNLMERAGPRQKIFFNPHHVHAGIVTCGGLCPGLNDVIRAIVRCLWGRYGVKRISGIRF
GYKGLLPDYNFDILPLTPEVIDNCHKTGGSLLGTSRGGGNRVVDIVDGIERLNLHILFII
GGDGSQKGAKEIADEIKHRNLKISIIGIPKTVDNDISFVQKSFGFDTAIVKATEAVAAAH
MEARSQINGIGLVKLMGRESGFIATYTAIASHETNFVLIPEVSFDLDGPNGLLAHLEKRI
ALRKHAVLVVAEGAGQDLMVNADGVPSGDSQGGSLRVSSGTDASGNKRLADIGLFLKEKI
GVYFKEKRIHINLKYIDPSYLIRSAVAAPIDSIYCERLGNNAVHAAMCGKTKMIIGLVHN
KFVHLPIDVVVCQRKHVNPEGSLWRDALDATGQPIVMKNII
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcttcctaaagagtacgatttttctatagagtcattgggggaaagcaaaatt
ccctctcccatctacctgtctcacacccttggcgacttcattcctaactacgtcagtgac
aatgagtacatcagccatgaactgagtgcgcgtctgggggagacggtagggccctttact
cataaaaacttgatggagcgtgcgggcccgcgccagaagattttcttcaacccgcatcac
gttcatgcaggtattgtcacctgtggagggctctgtcccggcctcaacgatgtcattcgc
gccatcgtccgctgcctttggggccgctatggcgttaagcgcattagtggtatccgcttt
ggctataagggcctcttgcccgattacaacttcgatatcctgccgctcacccctgaggtc
atcgataactgccacaaaacaggtggttcgctgctaggcacctcgcgcggtggggggaac
cgtgtggttgacatcgtcgatggtatcgagcggctcaacctgcacattctctttatcatt
gggggggatgggagtcagaagggagcaaaagagattgccgacgaaataaaacaccgcaac
cttaagatttccatcatcggcattcccaaaacggtggacaacgacatctcttttgttcaa
aagtcatttggcttcgatactgctattgtcaaagcaacagaggcagttgccgcagcgcac
atggaggctcgttcacagattaacggcattggactggtcaaactcatggggcgtgagtct
ggattcatcgctacgtacacggcgattgcgagccatgagacaaacttcgtactcatccct
gaagtgagctttgaccttgacggtccaaatgggcttttggctcacctagagaagcgaatc
gcgctacgtaagcatgcggtgctcgttgtagcagaaggtgcggggcaagacctaatggta
aatgcggacggtgtgccctccggtgattcccaaggaggtagtttgcgcgtgagcagcggc
acggatgcgtcgggtaacaagcgccttgcggatatcggtttgttcttaaaagaaaagatt
ggagtctatttcaaagaaaagcgtatacacatcaatttaaagtacatcgatccgagctac
ttgattcgttccgcggttgctgcgcccatagattcgatttactgcgaacgcctcggtaac
aatgcggtgcatgcggcgatgtgcggtaaaacgaaaatgatcattggcttggtgcacaat
aagtttgtacacctcccaatcgatgtggtggtgtgccaacgcaaacacgtaaatcctgaa
ggatcgttgtggcgcgacgcccttgatgcaacaggacagccgattgtgatgaaaaatatt
atctag

DBGET integrated database retrieval system