KEGG   Treponema pallidum subsp. pallidum DAL-1: TPADAL_0168Help
Entry
TPADAL_0168       CDS       T01748                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpu  Treponema pallidum subsp. pallidum DAL-1
Pathway
tpu00010  Glycolysis / Gluconeogenesis
tpu00260  Glycine, serine and threonine metabolism
tpu00680  Methane metabolism
tpu01100  Metabolic pathways
tpu01110  Biosynthesis of secondary metabolites
tpu01120  Microbial metabolism in diverse environments
tpu01130  Biosynthesis of antibiotics
tpu01200  Carbon metabolism
tpu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPADAL_0168
  Energy metabolism
   00680 Methane metabolism
    TPADAL_0168
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPADAL_0168
Enzymes [BR:tpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TPADAL_0168
Membrane trafficking [BR:tpu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TPADAL_0168
Exosome [BR:tpu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TPADAL_0168
  Exosomal proteins of melanoma cells
   TPADAL_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEZ60495
Position
190218..190973
Genome map
AA seq 251 aa AA seqDB search
MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRA
IRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTETAQKYGEQQVRVWRRSFDVAP
PPLTVGDARCPHTQASYRGVCASGRTPVLPFTESLKDTVARVVPYFEEEIKPQMISGQRV
LIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEADFTLCGKRFLGNEADVAAR
AQAVADQGKSN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgtgttgatccgtcatggagaaagtgaatggaacaggctgaacctgttcact
ggttggacagatgttccgcttaccccacgtggggagtcggaagcccaggaaggaggccgc
gtactgcaagaagcggggtttgattttgacctatgctacacttctttcttgaaacgtgcc
attcgtacgctcaattttgtactccaggcactggaccgtgagtggttgccggttcacaaa
agctggaaattgaacgagcggcattatggggatctacaaggtttaaataagacagagacg
gcgcagaagtatggtgagcagcaggttagggtgtggcgtcgctcctttgatgtggctcct
cctccgcttactgtaggggacgcacgttgtccgcatactcaagcctcctaccggggggta
tgcgcgtctggtcggacgccagtacttccgtttacggaaagtttgaaagataccgttgcg
cgtgtggtgccgtattttgaagaggaaatcaaaccgcagatgatttccggacagcgtgtg
cttattgtggcgcatggtaactcgttgcgcgcactgatgaagcacatagagtctttggat
gagactcagataatggaagtaaatttgcctaccggtgtaccgcttgtctatgagttcgag
gcggattttaccctgtgtgggaagcgttttttaggtaatgaggcggatgttgcagcgagg
gcgcaggctgtggctgatcagggtaagagtaactaa

DBGET integrated database retrieval system