KEGG   Treponema pallidum subsp. pallidum DAL-1: TPADAL_0300Help
Entry
TPADAL_0300       CDS       T01748                                 

Definition
sugar ABC superfamily ATP binding cassette transporter, ABC protein
Orthology
K02056  
simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
tpu  Treponema pallidum subsp. pallidum DAL-1
Module
Putative simple sugar transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313371..315131
Genome map
AA seq 586 aa AA seqDB search
MMIAERGVRASARGVLSLHHIGKTYPRVMPRSKRGVWGMFGHPGRRAVDDAHTAHGPCSG
ARETDAAEHSVLSDVNLSFFTGEIHALLGKNGAGKSTLAHILSGFCVPTHGQLRLDGKEQ
RFSVPFDALRAGIGIVHQQPVFAERATVFENVVMGSAALTGVRWVRRAQVRERIDRIIAQ
WRMPLKKEEYVACLSADKRFFVSLLCVLFRNPRFIILDEPRCAPAQSRAVFFSHLEEFFV
RSSHAPRCGGGVIVVTHRFADALRWAQRISLIEGGKACSFLRTDLLDEYCSAHQVNECIQ
KVSCALMSASTVTSSAVSSFSSLSDTQSCATVPRTSSARPWVLRVESLQVSKHADVPLTD
ISFSVAASAIIGIVGTPEDGVHVLEDILCDMHAGASRTHCTGNILLQEHDQVWCLPLQRN
TPSLLRAHGVACVPSNCIQRGASMQLTLFDLLVPYTLRTWRTRVRAQMRFVARLLAEEEI
YCDPLQPACTLSGGQLQRVILARELATRPRLLILAEPAEGLDSASEQRLLARLRQVAQAG
TALVLLAREQHQAQWRALCTERFLLRAGTLCAEVSGTPSPSQDSHT
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttgatgatagctgagcgcggcgttagggcatctgcgcgcggtgtgctctcgcttcaccat
attgggaaaacctacccgcgcgtgatgccgcgttcaaagcgcggggtctggggtatgttc
ggtcaccctggcaggcgcgcagtcgacgatgcgcacacagcgcatggcccgtgttcgggc
gcgcgtgagacggacgccgctgagcacagcgtgctcagcgatgtgaatctttcctttttt
accggtgaaattcacgcgttgttgggaaaaaatggtgcaggaaaatccacgcttgcgcat
attctttcgggcttttgcgtgccgacgcatgggcagctccgtctggatggaaaggagcag
cgcttctccgtacccttcgatgcgctccgtgcaggaattggcatagtgcaccagcaaccg
gtatttgcagaacgcgcaacagtatttgaaaatgtagtgatgggtagtgctgcactcacc
ggcgtgcggtgggtgcgccgtgcacaggtgagagaacgcatagatcgcattatcgcccag
tggcgtatgcccttgaagaaggaagaatacgttgcatgtttgagtgcagacaagcggttt
tttgtatcgttgctctgtgtattgtttcgcaatccgcgtttcatcatcctggatgagccg
cggtgtgctccggcgcaatcgcgtgcggttttcttttctcatcttgaagagttttttgtg
cgttcttcgcacgcgccccggtgtggtggcggagtgatagtagtgacgcaccgatttgct
gatgcattgcgatgggcacagcgtatttctttgatagaagggggaaaagcgtgcagtttt
ctgcgtacggatcttttagacgaatactgttctgcgcatcaggtgaatgaatgtattcag
aaagtgtcctgtgcgctcatgtccgcatcaacggtgacttcttctgccgtaagttctttt
tcctctctgtcagatacccagtcgtgcgcaactgtgccgcgcacatcttctgctcgtcct
tgggtgttgcgcgttgagtcgctgcaggtgagtaaacacgcagacgttccgctcacagat
atttcgttttctgtggccgcatctgctatcatagggatagtcggtacgccagaagatggt
gtgcacgtattggaagatatactgtgtgatatgcacgctggggcgtcgcgtacgcactgc
accgggaatattcttttgcaggagcacgatcaggtgtggtgtctccccctccagcgcaat
acgccctcgctgctgcgggcacacggggttgcgtgtgtgccgtctaattgcatacagcgc
ggtgcctcaatgcagttaactctttttgatttgctcgttccctacacgttgcgtacgtgg
cgcacgcgtgtgcgcgcccagatgcgctttgttgctcgtcttcttgcagaagaagaaatt
tactgcgatccgttgcagcctgcctgtacgctttcaggcggacagttgcagcgcgttatt
ttagcgcgtgagcttgcaacgcgtccacgtcttctcattttggcagaacctgcagaagga
ttggatagcgccagtgaacagcgcttgcttgcacgtctgcgccaggtagcacaggcagga
actgctcttgtgctccttgcgcgagaacagcatcaggcacagtggcgtgcgttgtgcaca
gaacgtttcttgctacgtgcaggtacgttgtgtgctgaagtgtcaggcactccgtctccg
tctcaggattctcatacgtga

DBGET integrated database retrieval system