KEGG   Treponema pallidum subsp. pallidum DAL-1: TPADAL_0543Help
Entry
TPADAL_0543       CDS       T01748                                 

Gene name
ruvA
Definition
crossover junction endoribonuclease subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tpu  Treponema pallidum subsp. pallidum DAL-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tpu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(586859..587542)
Genome map
AA seq 227 aa AA seqDB search
MFESISGILTLHERERLCVEVHGIEWEIAVSAYSSAAFGEVGSHVKVFTWLYHREDALRL
FGFSNVQERTLFLSLTKVEGIGPKQALKVLSSISSQALCAALDTGDLCALQRIPGIGKKT
AQRMLLALKGTLALTDAASCAQSQTDDRAAHPSNLGCAPHAREIEDLVTALVQMGYDRKM
AAEVIAQESAALCSVGRSLYEEEATVLKRAILALSIAHPHAVAPAAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaagcatcagcggtatcttgacgctccatgagcgcgagcgcctctgtgttgag
gtgcatggtattgaatgggaaattgcagtgtccgcatacagtagtgctgcgttcggtgag
gttggatcacacgttaaggtctttacctggttgtatcaccgtgaagatgcgcttcgcctc
tttggtttttcgaatgtacaagagcgcacgctctttctcagtcttacaaaggtagaaggt
attggtccaaagcaggcgctcaaagttctttcgagtattagcagtcaggctttgtgtgca
gcgcttgatacaggagatttatgtgcactccagcgcataccaggcattggaaaaaagact
gcacagcgcatgctcttagcgctgaaaggtacgctcgcgctaaccgacgcggcctcttgt
gcccagagtcagacagatgatcgtgctgcacatccgagcaatcttgggtgtgctccccat
gcgagggaaattgaggatctggtaactgctcttgtacagatgggatacgacaggaaaatg
gcggcggaggtgatcgcacaggagagcgctgcgttgtgcagtgtggggcgttcactgtat
gaagaagaagcgacggttcttaaacgtgctattcttgcgttgagtattgcgcatccacac
gcggtcgcgcctgctgcagagtga

DBGET integrated database retrieval system