KEGG   Theileria parva: TP01_0140Help
Entry
TP01_0140         CDS       T00254                                 

Definition
mRNA export protein
Orthology
K14298  
mRNA export factor
Organism
tpv  Theileria parva
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TP01_0140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 359 aa AA seqDB search
MSFSRTTFDEQPQKFMLNNLPNDSISHLRWSTTTNPLLLTAGSWDKTLRIWKVTTGLGNA
VNTDMVYTFKQDAPVLCSAFSTDSMRLFGGGCTNNVLAYDLNNPSSTGVVIARHQKPVSG
VHWIPQFNLLLSTSWDGGVSLWDGRQENPVWSENLGAKVFASDVKDNLMCVADSNRKLSV
WSLEKLQHSNSKITIDSSLKLQIRALSLFPDTKVRSGVAYSSIGGRCVVNYFTEEEKKNN
FSFKCHRQDQPGKGTFTYSVNAIDFHAVYGTFVSGGGDGTFTIWDKDNKSRVKAFSNLGA
PVVDVKFMSEGNLLAFATSYDWYKGLNHSLITNTSKSIGIVKLKEEDIKSKPRPFGSRR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcacgtaccacattcgatgaacaacctcaaaagtttatgctaaataactta
ccaaatgactccatttcacatctaagatggagtacaaccacaaaccccctgttactaaca
gctgggagttgggacaagactcttaggatttggaaagttaccacaggcctcgggaacgca
gttaatacggatatggtatacacttttaaacaggacgctcccgtactctgctctgctttc
tccacagactcaatgcgtttatttggagggggctgtacaaataatgtgttagcgtatgat
ttaaataacccgagtagtacgggagtagtcatagcaaggcaccagaagccagttagtgga
gtacattggattccccagttcaacttactgttgtccacaagttgggatggcggtgtaagt
ttatgggatggaagacaagaaaacccagtgtggtcagagaacttgggcgctaaagttttc
gcgtctgatgttaaggataatttaatgtgtgtagcagacagtaaccgaaagctcagtgtc
tggagtcttgagaagctccaacactccaacagtaaaataacaattgattccagtttaaag
ctccaaattcgagcattatcgctatttccagacactaaagtacgttcaggggttgcatac
agctcaattggcggtcgctgtgtagtaaactactttacagaagaggaaaagaagaataat
ttctccttcaagtgtcataggcaggaccagcctggcaagggcacttttacatattcagta
aatgcaattgatttccacgcagtgtacggcactttcgtctcaggaggaggtgatggcacc
tttaccatctgggataaggataacaagtcgagagttaaggccttttccaatttaggagca
ccggtagttgacgtcaagttcatgtcggaaggtaacctcctggcctttgccacaagctat
gactggtacaaaggcctaaatcactcgttaataaccaacactagtaaatctatcggaatc
gtcaagttgaaggaagaagatataaagtccaagccgagaccctttggatcacgtagatga

DBGET integrated database retrieval system