KEGG   Theileria parva: TP01_0149Help
Entry
TP01_0149         CDS       T00254                                 

Definition
serine/threonine protein kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
tpv  Theileria parva
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 559 aa AA seqDB search
MTHYDDENKMYDNEKLNSEDGYYRKRDSSRINDRRRSSRRKYSSRRMYHSSNYRHKRRKH
SRHKSYSSSPSYSRSSTHNTTEPSDSIHRSRSKSSKDSSESDTRSYSDRNHRRYSGSSSL
DRRRYRNHNKYSHRHRDRSRDRYRYRDRRYSRRSHRPSRRYSHRRDYSRSYRRRYRRSYS
PSHRHKYSHRDRYSHRHRYSGRDKYADRAKSPTDEIIHFKWDKGMNLSEYVVLNKVSDGT
FGRVLLCEKEGKQFAVKVVRDVDKYTQSAKIEADILLDIKSSDVNSESHCVVLHDNFMYR
NRNMCLVFEKLGPSLYDFLEKNDFKGFFISDIQNMAYQLLKGLSFLKKKRLVHTDIKPEN
ILLVCGKDDFIEVPFPRSHTGMTTKRPAMSDIKLIDFGSAIYEDEYHSSIINTRQYRAPE
VILDIGWSYSSDLWSLGCTLMELYTGHLLFRTHSHMEHLAMMEKTLGKFPEEVINSAKNT
QGKNYISPNEPRLNWPEGAKSKSSVHRVEECKTIMDLVKPEHRLFGEFIRYILNLDSNKR
PTPEEAMQHEFFTLKLPEN
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacccactatgatgacgaaaataaaatgtatgataatgaaaaattaaattccgaagat
ggatattatcgcaaacgagattccagtagaataaatgaccgtagaaggtcgagccgtaga
aaatatagtagccgccgtatgtaccattcctctaattataggcataaacgacgcaaacat
tccagacataaaagttattccagttccccttcctacagtagaagttcaactcataatacc
actgaacccagtgattccattcatcggagccgtagtaaaagtagcaaggattcctcagaa
agtgataccaggagttatagcgataggaaccatagaagatactcagggagctcaagccta
gatcgtcgtcgttaccggaaccataataaatatagccataggcatagagatagaagcaga
gataggtatagatatagagacagaaggtatagtagaagatctcacagaccaagtagaaga
tactcccatagacgtgattactcaagatcttatagaagaagatatagacgcagctactcc
ccgtcacataggcacaaatactcacatagagataggtacagccataggcacaggtatagt
ggtagggataagtatgctgacagagccaagtcacccacggatgaaattatccatttcaag
tgggacaagggtatgaatttatcagagtacgtggtcttgaataaagtgagtgacggaaca
ttcggtagagtgttattatgtgaaaaggaaggcaaacaatttgcagtcaaggttgtgagg
gacgtcgacaaatacactcaatcggcaaagattgaggcagatatacttttggatataaag
agctcggacgttaattccgagagtcattgcgtggttttacatgacaactttatgtacagg
aacagaaacatgtgtttggttttcgagaaacttggcccttcactatacgattttttggaa
aaaaatgattttaaaggctttttcatttcagatatacagaacatggcctatcagcttctg
aagggactttcgtttcttaagaaaaaacgcctagtccacacagatattaaacctgagaat
atactgctagtatgtggaaaagatgatttcatagaagtaccatttccaagatcacatact
gggatgacgactaaaagaccagctatgtcagatattaaactaattgactttggaagcgct
atttatgaagatgagtatcacagctcaattattaatacaagacagtacagagcaccagaa
gttattctagatattggatggagctactcgagtgatctgtggtcattaggatgtacacta
atggagttgtacacaggacatttactctttagaacacacagtcacatggaacacttggca
atgatggaaaagactctcgggaaattcccagaagaagttataaattctgctaaaaatact
caaggaaaaaactacattagtccaaatgaacccagactcaactggcctgaaggcgcaaaa
tcaaaatcatcagttcacagagttgaagagtgtaaaaccataatggatttggtaaagcct
gaacacagactttttggagaatttatcagatatatactaaatttagactcgaataaaaga
ccaacaccggaagaagcaatgcagcatgaattttttactttaaaattaccagaaaactaa

DBGET integrated database retrieval system